KEGG   Mus musculus (mouse): 74048Help
Entry
74048             CDS       T01002                                 

Gene name
Vsir, 4632428N05Rik, Dies1, PD-1H, VISTA
Definition
(RefSeq) V-set immunoregulatory receptor
  KO
K23268  V-type immunoglobulin domain-containing suppressor of T-cell activation
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    74048 (Vsir)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set ig Ig_3 Ig_2 I-set
Motif
Other DBs
NCBI-GeneID: 74048
NCBI-ProteinID: NP_001153044
MGI: 1921298
Ensembl: ENSMUSG00000020101
Vega: OTTMUSG00000016473
UniProt: Q9D659
Position
10; 10 B4
AA seq 308 aa AA seqDB search
MGVPAVPEASSPRWGTLLLAIFLAASRGLVAAFKVTTPYSLYVCPEGQNATLTCRILGPV
SKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLEL
ASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMAS
NEQDSDSITAAALATGACIVGILCLPLILLLVYKQRQVASHRRAQELVRMDSNTQGIENP
GFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLLSDPSTPLSPPGPGDVFFPSLDPVP
DSPNSEAI
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtccccgcggtcccagaggccagcagcccgcgctggggaaccctgctccttgct
attttcctggctgcatccagaggtctggtagcagccttcaaggtcaccactccatattct
ctctatgtgtgtcccgagggacagaatgccaccctcacctgcaggattctgggccccgtg
tccaaagggcacgatgtgaccatctacaagacgtggtacctcagctcacgaggcgaggtc
cagatgtgcaaagaacaccggcccatacgcaacttcacattgcagcaccttcagcaccac
ggaagccacctgaaagccaacgccagccatgaccagccccagaagcatgggctagagcta
gcttctgaccaccacggtaacttctctatcaccctgcgcaatgtgaccccaagggacagc
ggcctctactgctgtctagtgatagaattaaaaaaccaccacccagaacaacggttctac
gggtccatggagctacaggtacaggcaggcaaaggctcggggtccacatgcatggcgtct
aatgagcaggacagtgacagcatcacggctgcggccctggccaccggcgcctgcatcgtg
ggaatcctctgcctcccccttatcctgctgctggtctataagcagagacaggtggcctct
caccgccgtgcccaggagttggtgaggatggacagcaacacccaaggaatcgaaaaccca
ggcttcgagaccactccacccttccaggggatgcctgaggccaagaccaggccgccactg
tcctatgtggcccagcggcaaccttcggagtcaggacggtacctgctctctgaccccagc
acacctctgtcgcctccaggccctggggacgtctttttcccatccctagatccagtccct
gactcccctaactctgaagccatctaa

DBGET integrated database retrieval system