KEGG   Mus musculus (mouse): 74054
Entry
74054             CDS       T01002                                 

Gene name
4931406B18Rik, 4930538L19Rik
Definition
(RefSeq) RIKEN cDNA 4931406B18 gene
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Ig_2 Ig_3 C2-set_2 DUF2207 Cadherin_C_2
Other DBs
NCBI-GeneID: 74054
NCBI-ProteinID: NP_083013
MGI: 1921304
Ensembl: ENSMUSG00000013353
Vega: OTTMUSG00000036021
UniProt: A2RSL7
Position
7; 7 B3
AA seq 367 aa
MRWGLTSLLLLYLGLLSPVLVDVKKTAMEDGLCSMVPCVIEFYKAPFRNPMAVSYRLNEN
ISFRVGTSHPSAPMGDLSTEEVEYCILMTHSMLRRKYMTNSLYVGLGTQKDLTQNPELHI
PESSVAGEPVTLSCTIQSTCQEPNALFLSWKGPIMSSNTTISIHPSSALAIELKPEDQGT
TLRCHLKLSLDNLSSSKVVKLQLVSPTRLLNYSCLLKRTLTCSCSFHGIPTPLVQWWVGG
TPVSVNRIDGILHLTTTTLEPWTNSTIHLIWEPEIIRRLRCEGKNQYGVHASRIFLIPDK
SSVSSVFLRGLIQGIVYGAIASALFLFFLVVLVMKMLNWWEENQTCKNKEAPTPVKPVLG
GANAAEV
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgcggtgggggctcacatccctacttctgctgtatttggggttactttctccagttttg
gttgatgtcaagaagacagcaatggaagatggtctatgcagtatggtcccttgtgtgatt
gaattttacaaggcacctttcagaaatcccatggctgtgagctataggcttaatgaaaat
atcagcttccgtgttggtaccagccatcccagtgcccccatgggtgatctctccacagag
gaggtggaatactgcatcctgatgacccacagcatgctcagaagaaaatacatgaccaat
tcactctatgtgggtctaggaactcagaaagacctgacccaaaacccagagcttcacatc
ccagaaagtagtgtggctggagagcctgtgactttgagctgtaccatccaaagcacctgc
caagagcccaacgctctttttctctcctggaaaggacccatcatgtcttccaacacaacc
atctccattcacccctcttcagcactggccattgaactgaaacccgaggaccagggcacc
actctcagatgccacttaaagctatccctagataacttgtccagcagtaaagtggtcaag
ctacaactggtctcacccaccaggctgctcaactactcctgtttgctgaagaggacactc
acatgtagctgttccttccatgggatccccacacctttggtgcagtggtgggtgggagga
acccctgtgagtgtgaatagaatagatggcatcctacacctgactaccaccacactagaa
ccctggaccaatagcaccattcacctcatttgggaaccagaaatcattaggagacttcgc
tgtgaggggaagaaccaatatggagtccatgcttctagaatcttcttgataccagataaa
agctccgtttctagtgtgttcctgagaggtctaatccagggcattgtgtatggggccata
gcgtcggctttattcctcttcttcctcgttgtgctggtaatgaagatgcttaattggtgg
gaagaaaatcaaacctgcaagaacaaagaagccccgacccccgtgaaaccagttttggga
ggagccaacgctgctgaagtctga

DBGET integrated database retrieval system