KEGG   Mus musculus (house mouse): 74088
Entry
74088             CDS       T01002                                 
Symbol
Them7, 0610012H03Rik
Name
(RefSeq) thioesterase superfamily member 7
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: 4HBT Acyl-ACP_TE 4HBT_2
Other DBs
NCBI-GeneID: 74088
NCBI-ProteinID: NP_001153110
MGI: 1921338
Ensembl: ENSMUSG00000055312
UniProt: Q9DCP4
Position
2:105054687..105210205
AA seq 199 aa
MIPWAWRLLPRNAARSVSTSSANQRAEDPHRQLEAYGYFLPIQTRWQDNDQNSHVNNAVY
YSYFDTVISHYLIRYCGLKTSLLTSPQVGFMVTNQCKFHTPISFPQTPLAALAVEKVGRS
SVCYRLALFPPKPTKELPSVNHHDLIDGLFAGHPKLAQFDTLACTTGSSVHVFVNPATNK
PENLPEDFRRGLQKLMSPA
NT seq 600 nt   +upstreamnt  +downstreamnt
atgattccttgggcatggaggcttcttcctagaaatgccgctcgttccgtatctacatca
tcagccaatcagcgagccgaagatccccaccggcagctggaggcctatggatacttcctc
cccatccagacccggtggcaggacaatgaccagaatagccacgtgaacaacgctgtgtac
tacagctacttcgacactgtaatcagccactacctgatcaggtactgtggcctgaaaacc
agcttgctgacatccccccaggtggggttcatggtgaccaaccagtgcaagttccataca
cccatcagcttccctcagaccccactggctgccctggctgtggagaaagtcggtcgctcc
agtgtgtgttaccgactggctctgtttcctcctaaacccaccaaggagctgccttcagtc
aatcaccatgatctcattgatggtttgttcgcaggccaccctaaattagcacagtttgac
actctggcatgtaccacggggtcttcagtccatgtctttgtgaatccagccactaacaaa
ccagagaaccttccagaggatttcaggaggggtctccagaagctgatgagtccagcatag

DBGET integrated database retrieval system