KEGG   Mus musculus (mouse): 74096Help
Entry
74096             CDS       T01002                                 

Gene name
Hvcn1, 0610039P13Rik, AI450555, BTS, HV1, Vsop., mVSOP
Definition
(RefSeq) hydrogen voltage-gated channel 1
  KO
K22644  voltage-gated hydrogen channel 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    74096 (Hvcn1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Proton channel, voltage-gated (Hv)
   74096 (Hvcn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VGPC1_C Ion_trans
Motif
Other DBs
NCBI-GeneID: 74096
NCBI-ProteinID: NP_001035954
MGI: 1921346
Ensembl: ENSMUSG00000064267
Vega: OTTMUSG00000022575
UniProt: Q3U2S8
Structure
PDB: 

Position
5; 5 F
AA seq 269 aa AA seqDB search
MTSHDPKAVTRRTKVAPTKRMSRFLKHFTVVGDDYHTWNVNYKKWENEEEEEEPAPTSAE
GEGNAEGPDAEAGSASTPRQSLDFRSRLRKLFSSHRFQVIIICLVVLDALLVLAELLLDL
KIIEPDEQDYAVTAFHYMSFAILVFFMLEIFFKIFVFRLEFFHHKFEILDAFVVVVSFVL
DLVLLFKSHHFEALGLLILLRLWRVARIINGIIISVKTRSERQILRLKQINIQLATKIQH
LEFSCSEKEQEIERLNKLLKQNGLLGDVN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacttcccatgacccaaaggccgtcactcgcagaaccaaggtggctcccaccaagagg
atgagcaggttcttgaaacactttacggtggttggggacgactaccacacgtggaatgtc
aactacaagaagtgggagaatgaggaggaggaggaggagccagcgcccacatcagcagag
ggtgagggcaatgctgagggcccagatgccgaggctggctctgcctccacgcccaggcag
tccctggacttcaggagccgactgaggaaactcttcagttcccacaggtttcaggtcatc
atcatctgcctggtggtcctggacgccctcctcgtgcttgctgaactcctcctggatttg
aagatcatcgagccggacgagcaagactatgcggtcacggcgttccactacatgagcttt
gccatcctggtcttcttcatgttggagatttttttcaagatcttcgtcttccgcttagag
ttcttccaccacaagtttgagatcctggatgccttcgtggtggtggtgtctttcgtcctt
gaccttgtcctcttgtttaaaagccaccacttcgaagctctagggctgctgatcttgctt
cggctctggagggtggcccggatcatcaatggcatcatcatctccgtgaagacacgctca
gaacggcagatcttaaggctaaagcagataaatatccaactggccaccaagatccagcat
ctggaattcagctgctccgagaaggaacaagaaattgagcggctcaacaagctgttgaaa
cagaatggacttctcggggacgtgaactag

DBGET integrated database retrieval system