KEGG   Mus musculus (mouse): 74107
Entry
74107             CDS       T01002                                 

Gene name
Cep55, 1200008O12Rik, 2700032M20Rik
Definition
(RefSeq) centrosomal protein 55
  KO
K16456  centrosomal protein CEP55
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    74107 (Cep55)
   03036 Chromosome and associated proteins [BR:mmu03036]
    74107 (Cep55)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Midbophagy associated proteins
    74107 (Cep55)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    74107 (Cep55)
SSDB
Motif
Pfam: EABR CC2-LZ HTH_34 zf-C2H2_3
Other DBs
NCBI-GeneID: 74107
NCBI-ProteinID: NP_001157834
MGI: 1921357
Ensembl: ENSMUSG00000024989
UniProt: Q8BT07
Position
19; 19 C2
AA seq 462 aa
MSSRSPKDLIKSKWGSRPSSSKSDTALEKFKGEIAAFKTSLDEITSGKGKMAEKGRSRLL
EKIQVLEAEREKNVYYLLEKDKEIQRLKDHLRSRYSSSSLFEQLEEKTKECEKKQQLLES
LSKETDVLKNQLSATTKRLSELESKASTLHLSQSMPANCFNSSMNSIHEKEMQLKDALEK
NQQWLVYDQQREAYVKGLLAKIFELEKRTETAAASLTQQMKKIESEGYLQVEKQKYDHLL
ENAKKDLEVERQAVTQLRLELDEFRRKYEEARKEVEDLNQLLSSQRKADIQHLEEDKQKT
ERIQKLREESSIFKGKLEEERKRSEELLSQVRILYDSLLKHQEEQARVALLEQQMQACTL
DFENEKLDRQNMQHQLYVILKELRKAKSQITQLESLKQLHGFTITEQPFPLQREPESRVK
ATSPKSPSAALNDSLVECPKCSVQYPATEHRDLLVHVEYCMK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtcttcaagaagtcccaaagatttaattaaaagcaaatggggatcaaggcctagtagc
tccaagtcagacactgcattagagaaatttaagggagaaattgcagcctttaaaacatcc
ctggatgaaatcacctctgggaaaggaaaaatggccgaaaaaggcagaagcagactcttg
gagaaaatccaagttcttgaagccgagagagaaaagaatgtttattacctcctggagaag
gacaaagaaatacagagactcaaagaccacctaaggtcaagatatagctcttcttcattg
ttcgagcagctggaagagaaaacaaaggaatgtgagaagaagcagcagttgctggagtcc
ctatccaaagagacagatgtcctgaaaaaccagctgtccgccacgacgaaaagactttct
gaacttgaaagcaaagccagtacactccacctgtcacagagcatgcctgcaaactgcttc
aactcctcaatgaatagtattcatgaaaaggagatgcagctgaaagatgctctggagaaa
aaccagcaatggcttgtgtatgatcagcagcgagaggcctacgttaaagggcttttagca
aagatcttcgagctggaaaagagaacagagacagccgctgcttccctcacacagcagatg
aagaagattgaatcagaaggttatcttcaagtggagaagcaaaaatatgatcatctcttg
gaaaatgccaaaaaagatctcgaagttgagcgacaagccgtgactcagttgcgtttagaa
ctcgatgaatttcgaaggaaatacgaagaagctcgaaaagaagttgaagacttaaatcag
ctgttgagctctcagcgaaaggcagacatccagcacctggaggaggacaagcagaagacg
gagaggatccaaaagctgagggaagagagcagtatcttcaagggaaagctggaagaggag
aggaagaggtcggaggagctcttatcccaggtccgaattctctacgattctctgttaaag
caccaagaggagcaggccagggtagctctactggaacagcagatgcaggcatgtactcta
gactttgaaaatgaaaaactcgaccgccagaatatgcagcatcaactctatgtgattctt
aaggaactccgaaaagcaaaaagtcaaataacacagttggaatccttgaagcagctacat
gggtttaccatcacagagcagccattcccactccagagagaacctgaaagcagagtgaaa
gctacctcacccaaaagtcccagtgctgcactcaatgacagcctagtggaatgtcccaag
tgcagcgtacagtacccagccaccgagcatcgagacctgcttgtccatgtcgaatactgc
atgaagtag

DBGET integrated database retrieval system