KEGG   Mus musculus (mouse): 74114Help
Entry
74114             CDS       T01002                                 

Gene name
Crot, 1200003H03Rik
Definition
(RefSeq) carnitine O-octanoyltransferase
  KO
K05940  carnitine O-octanoyltransferase [EC:2.3.1.137]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    74114 (Crot)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.137  carnitine O-octanoyltransferase
     74114 (Crot)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 74114
NCBI-ProteinID: NP_076222
MGI: 1921364
Ensembl: ENSMUSG00000003623
Vega: OTTMUSG00000024301
UniProt: Q9DC50
Structure
PDB: 

Position
5; 5 A1
AA seq 612 aa AA seqDB search
MENQLTKSVEERTFQYQDSLPSLPVPALEESLKKYLESVKPFANEDEYKKTEEIVQKFQE
GAGKRLHQKLLERARGKRNWLEEWWLNVAYLDVRIPSQLNVNFVGPCPHFEHYWPAREGT
QLERGSMMLWHNLNYWQLLRREKLPVHKSGNTPLDMNQFRMLFSTCKVPGITRDSIMNYF
KTESEGHCPTHIAVLCRGRAFVFDVLHEGCLITPPELLRQLTYIHKKCSNEPVGPSIAAL
TSEERTRWAKAREYLISLDPENLTLLEKIQTSLFVYSIEDSSPHATPEEYSQVFEMLLGG
DPSVRWGDKSYNLISFANGIFGCCCDHAPYDAMVMVNIAHYVDERVLETEGRWKGSEKVR
DIPLPEELVFTVDEKILNDVSQAKAQHLKAASDLQIAASTFTSFGKKLTKEEALHPDTFI
QLALQLAYYRLHGRPGCCYETAMTRYFYHGRTETVRSCTVEAVRWCQSMQDPSASLLERQ
QKMLEAFAKHNKMMKDCSHGKGFDRHLLGLLLIAKEEGLPVPELFEDPLFSRSGGGGNFV
LSTSLVGYLRVQGVVVPMVHNGYGFFYHIRDDRFVVACSSWRSCPETDAEKLVQMIFHAF
HDMIQLMNTAHL
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaattgactaaatcagttgaagaacggacatttcagtaccaggactctctt
ccgtcattgcctgttcctgcacttgaagaatcattaaaaaaataccttgaatcagtgaaa
ccattcgcaaatgaagacgagtataagaaaactgaagaaatagttcaaaagtttcaagaa
ggagctggcaaaagattgcatcagaagttacttgaaagggctagaggaaaacgaaactgg
ctggaagaatggtggctcaatgttgcctacctggacgtacgtattccatcacaactgaat
gtgaactttgtgggtccgtgtcctcattttgagcactactggcctgcaagggaaggcact
cagttagaaagaggaagcatgatgctgtggcacaacttgaactactggcagctgctaaga
agagaaaaattgcctgtacataaatctggaaatactcctctagacatgaaccaattccga
atgttgttttctacctgcaaggttccaggaattactagagattcgattatgaattatttt
aagactgagagtgaagggcattgtccaacccacattgccgtgctgtgtcgaggcagagcg
tttgtctttgatgtactacatgagggatgtttgatcaccccaccagaacttctcagacaa
ttgacatatatccacaagaagtgctcgaacgaacctgttggacccagtatagcggcatta
actagcgaggagcgaactcggtgggcaaaggcaagagaatatctgattagtcttgatcca
gagaacttgactttattagaaaaaattcaaaccagtttatttgtgtattccatagaagat
agcagtccacatgcaaccccagaagaatattctcaggtctttgaaatgcttcttggtgga
gatccatcagtacgctggggtgacaagtcctataatttgatttcctttgctaatggaata
tttggctgttgctgtgatcatgctccttacgatgcaatggtcatggtgaacattgcacat
tatgttgatgagagagtcctagagacagaaggaagatggaagggttcagaaaaagtccgg
gacataccattgccagaggagctggtcttcactgtggatgagaaaatactgaatgatgta
tcccaagccaaagcccaacatctcaaagctgcgtcagatctgcagatagcagcatctacc
ttcacatcttttggcaaaaagctcaccaaggaggaagcccttcaccctgatacctttatt
cagctcgctcttcagcttgcctactacagacttcatggacgccctggttgctgctatgag
acagctatgacaagatacttttaccacggccgaacagagactgtgcgatcttgtacagtg
gaggccgtcaggtggtgccagtccatgcaggatccctctgctagtctccttgaacgtcag
caaaagatgctagaagcttttgccaagcataataagatgatgaaagattgttcacatgga
aaaggatttgaccgtcaccttttaggtcttttgctcatagcaaaagaggaaggtctccct
gttccagaactatttgaggacccacttttctccagaagtggaggaggtggaaattttgtg
ctctcaacaagtttggttggttacttacgagttcagggtgttgtggttcccatggtacac
aatggatatggatttttctaccacatcagagatgacaggtttgtggtggcatgttcatcc
tggaggtcatgtccggagactgatgctgaaaagcttgttcagatgatttttcatgctttc
cacgatatgatacagctgatgaacaccgctcatctttag

DBGET integrated database retrieval system