KEGG   Mus musculus (mouse): 74126
Entry
74126             CDS       T01002                                 

Gene name
Syvn1, 1200010C09Rik, AW211966, C85322, D530017H19Rik, Hrd, Hrd1
Definition
(RefSeq) synovial apoptosis inhibitor 1, synoviolin
  KO
K10601  E3 ubiquitin-protein ligase synoviolin [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    74126 (Syvn1)
   04120 Ubiquitin mediated proteolysis
    74126 (Syvn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    74126 (Syvn1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     74126 (Syvn1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    74126 (Syvn1)
SSDB
Motif
Pfam: zf-RING_2 zf-rbx1 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-C3HC4_3 Zn_ribbon_17 zf-RING_5 zf-RING_11 Prok-RING_4 FANCL_C zf-ANAPC11 Zf_RING zf-RING-like zf-HC5HC2H zf-C3H2C3 RINGv Endonuclease_7
Other DBs
NCBI-GeneID: 74126
NCBI-ProteinID: NP_001158181
MGI: 1921376
Ensembl: ENSMUSG00000024807
Vega: OTTMUSG00000032981
UniProt: Q9DBY1 A0A0R4J1R1
Position
19; 19 A
AA seq 612 aa
MFRTAVMMAASLALTGAVVAHAYYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKV
MGKVFFGQLRAAEMEHLLERSWYAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLA
EDRVDFMERSPNISWLFHCRIVSLMFLLGILDFLFVSHAYHSILTRGASVQLVFGFEYAI
LMTMVLTIFIKYVLHSVDLQSENPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMIKVHTF
PLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVT
GAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPPEPADQGPPPAPHPQ
PLLPQPPNFPQGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAAAPPPTSTAVSRPSGAA
TTTAAGTSTSAPAPGSVPGPEAGPAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTP
EELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNPTEET
ASTVVSAAPSTSAPSSEAPTPSPGASPPIPEAEKPPAPESVGIVEELPEDGEPDAAELRR
RRLQKLESPVAH
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgttccgcaccgcagtgatgatggcggccagcctggcgctaaccggggcagtggtggct
catgcctactacctcaaacaccagttctaccccactgtagtgtatttgaccaagtccagc
cccagcatggcagtcctgtacatccaggcctttgtccttgtcttcctcttgggcaaggtg
atgggcaaggtgttcttcgggcagctgagggcagcagagatggagcaccttctggaacgg
tcctggtacgctgttactgagacttgtttggccttcaccgtttttcgggatgacttcagc
cctcgctttgtggcgctctttacgctgctcctcttcctcaaatgtttccattggttggct
gaagaccgtgtggactttatggaacgcagccccaacatctcctggctcttccactgccgc
atcgtctctctcatgtttctcctgggtatcctggacttcctcttcgtcagccacgcttat
cacagcatcctgacccgtggggcttctgtgcagctggtatttggctttgagtacgccatt
ctgatgaccatggtgcttaccatcttcatcaagtatgtgctgcactccgtggacctccag
agcgagaacccctgggacaacaaggctgtatacatgctctacacggagctgtttacaggc
ttcatcaaggtcctgctgtacatggccttcatgaccatcatgatcaaggtgcacacattc
ccactctttgccattaggcccatgtacctggccatgaggcagttcaagaaagctgtgaca
gatgccatcatgtctcgccgagccatccgcaacatgaacacactgtacccagatgccacc
cccgaggagctccaggcaatggataatgtctgcatcatctgcagagaagaaatggtgact
ggtgctaagagattgccttgcaaccacatctttcacacgagctgcctgcgctcctggttc
cagagacagcagacctgcccgacatgccgcatggatgtcctgcgggcatcgttgccagcc
cagtcaccaccacctcctgagcctgctgaccaaggaccaccccccgcccctcatccccaa
ccgctgctgccacagccccctaatttcccccagggcctcctgcctccttttcctccaggc
atgttcccactgtggcccccaatgggtccctttccacctgtcccgcctcccccaagctca
ggagaggctgcggcccctccacccaccagtacagccgtttctcggcctagtggagcagcc
accaccacagctgctggcaccagtacttctgccccagcacctgggtctgtacctggccca
gaggctggtcctgcccccggcttccctttccctcctccttggatgggtatgcctctgcct
ccaccttttgccttccccccaatgcctgtgccccctgcgggctttgctggcctaacccca
gaggagctgcgagcactagagggccatgagcggcagcacctggaggcccggctgcagagt
ctgcgcaacatacacacactactggatgctgccatgcttcaaatcaaccagtacctcact
gtgctggcttccctggggccccccaggccagctacttcagtgaaccccactgaagagact
gcctctacagtggtatctgctgccccttccaccagcgcccccagctctgaggctcctacc
ccgtctccgggagcttccccaccaattcctgaagcagaaaagcctcctgctcctgagtca
gtgggcattgtagaggagcttcccgaggatggagagcctgatgctgcagaactccgccgg
cgtcgcctgcagaagctggagtcccctgttgcccactga

DBGET integrated database retrieval system