KEGG   Mus musculus (mouse): 74137
Entry
74137             CDS       T01002                                 

Gene name
Nuak2, 1200013B22Rik, Omphk2, Snark, mKIAA0537
Definition
(RefSeq) NUAK family, SNF1-like kinase, 2
  KO
K08800  NUAK family, SNF1-like kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    74137 (Nuak2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     74137 (Nuak2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   74137 (Nuak2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo FTA2 RIO1 APH Haspin_kinase Seadorna_VP7
Other DBs
NCBI-GeneID: 74137
NCBI-ProteinID: NP_001181954
MGI: 1921387
Ensembl: ENSMUSG00000009772
Vega: OTTMUSG00000021956
UniProt: Q8BZN4
Position
1; 1 E4
AA seq 639 aa
MESVALLQRPSQAPSASALASESARPLADGLIKSPKPLMKKQAVKRHHHKHNLRHRYEFL
ETLGKGTYGKVKKARESSGRLVAIKSIRKDKIKDEQDLLHIRREIEIMSSLNHPHIIAIH
EVGRSRLVTVFENSSKIVIVMEYASRGDLYDYISERPRLSERDARHFFRQIVSALHYCHQ
NGIVHRDLKLENILLDANGNIKIADFGLSNLYHKGKFLQTFCGSPLYASPEIVNGKPYVG
PEVDSWSLGVLLYILVHGTMPFDGQDHKTLVKQISNGAYREPPKPSDACGLIRWLLMVNP
TRRATLEDVASHWWVNWGYTTGVGEQEALREGGHPSGDFGRASMADWLRRSSRPLLENGA
KVCSFFKQHVPGGGSTVPGLERQHSLKKSRKENDMAQNLQGDPAEDTSSRPGKSSLKLPK
GILKKKSSTSSGEVQEDPQELRPVPDTPGQPVPAVSLLPRKGILKKSRQRESGYYSSPEP
SESGELLDASDVFVSGDPVEQKSPQASGLLLHRKGILKLNGKFSRTALEGTTPSTFGSLD
QLASSHPAARPSRPSGAVSEDSILSSESFDQLDLPERLPETPLRGCVSVDNLRGLEQPPS
EGLKRWWQESLGDSCFSLTDCQEVTAAYRQALGICSKLS
NT seq 1920 nt   +upstreamnt  +downstreamnt
atggagtcggtggccttactccagcgcccgagccaggctccctcggcctccgccctggcc
tcggagagcgcccggccgctggcggacgggctcatcaagtcgcctaaacctctgatgaag
aagcaggcggtgaagcggcaccatcacaaacacaacctgcggcaccgctacgagttcctg
gagacgctgggcaagggcacctacgggaaggtgaagaaggcacgagagagctcggggcgt
ctggtggccatcaagtccatcaggaaagacaaaatcaaagatgagcaggatctgctgcac
atacggagggagattgagatcatgtcttcactcaaccacccccacatcattgccatccat
gaagtgggcagatcacgcttagtgactgtgtttgagaatagcagcaagattgtgattgtc
atggagtatgccagccgaggcgatctgtatgattacatcagtgagcggccacggctgagt
gagcgggacgccaggcatttcttccgacagatcgtgtctgccctgcactactgccaccag
aacgggatcgttcaccgagatctcaagctggaaaacatccttctagatgccaatggaaac
atcaagattgctgactttggcctctccaacctgtaccacaaaggcaagttcctccagacg
ttctgtgggagccctctctacgcctcgcctgagatagtcaacgggaagccctatgtgggc
ccagaggtggacagctggtctctgggcgttctcctgtacatcctggtgcatggcaccatg
ccctttgacgggcaggatcataaaacactggtgaagcaaatcagtaacggggcttaccgt
gagccgcccaagccgtccgatgcctgtggcctgatccggtggctgttaatggtgaacccc
acccgtcgggccacactggaggatgtagccagtcattggtgggtcaactggggttacacc
accggagtcggggaacaggaagccctgcgtgagggtgggcaccctagtggtgactttggc
cgggcctccatggcggactggttacgtcgctcctcgcgccccctcctggagaatggagcc
aaggtgtgcagcttcttcaagcagcacgtgccgggaggtggaagcactgtacctgggctg
gagcggcaacattctcttaagaagtcccgaaaggagaatgacatggctcaaaatctgcaa
ggtgacccggctgaggatacctcttctcgccctggcaagagcagccttaagcttccgaaa
ggcattctcaagaaaaagtcctctacctcgtcaggggaggtacaggaggaccctcaggaa
ctcagaccggtgcctgatactccagggcagcctgtccctgctgtatccctgctcccaagg
aaaggcatccttaagaagtctcgacagcgtgaatctggttactactcctctccagagccc
agcgagtctggggaactcttagacgccagtgatgtgtttgtgagtggggaccccgtggag
cagaagtctccacaggcttcagggctcctcctccaccgcaagggcattctcaaactcaat
ggcaagttctcccgcacagccttagaaggcactacccctagcacctttggctccctggac
caactggcctcctcccatcctgcagcccggcccagccgcccctcaggggctgtgagtgag
gacagcatcctgtcctccgagtcctttgaccaattggacttgcctgaacgtcttcccgaa
accccactgaggggctgtgtgtctgtggacaacctgagggggcttgagcagcctccctca
gaaggtctgaagcgatggtggcaggaatccttgggggatagctgcttttctctgacagac
tgccaagaggtgactgcagcctacagacaagccctaggaatctgctcaaagctcagctga

DBGET integrated database retrieval system