KEGG   Mus musculus (mouse): 74147Help
Entry
74147             CDS       T01002                                 

Gene name
Ehhadh, 1300002P22Rik, HD, L-PBE, LBFP, LBP, MFP, MFP1, PBFE
Definition
(RefSeq) enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00380  Tryptophan metabolism
mmu00410  beta-Alanine metabolism
mmu00640  Propanoate metabolism
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04146  Peroxisome
Module
mmu_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
mmu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
mmu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    74147 (Ehhadh)
   00650 Butanoate metabolism
    74147 (Ehhadh)
  Lipid metabolism
   00071 Fatty acid degradation
    74147 (Ehhadh)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    74147 (Ehhadh)
   00310 Lysine degradation
    74147 (Ehhadh)
   00380 Tryptophan metabolism
    74147 (Ehhadh)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    74147 (Ehhadh)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    74147 (Ehhadh)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    74147 (Ehhadh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     74147 (Ehhadh)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     74147 (Ehhadh)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     74147 (Ehhadh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N NAD_binding_2 TrkA_N Peptidase_S49 2-Hacid_dh_C F420_oxidored ApbA Methyltransf_11
Motif
Other DBs
NCBI-GeneID: 74147
NCBI-ProteinID: NP_076226
MGI: 1277964
Ensembl: ENSMUSG00000022853
Vega: OTTMUSG00000033863
UniProt: Q9DBM2
Position
16; 16 B1
AA seq 718 aa AA seqDB search
MAEYLRLPHSLAMIRLCNPPVNAISPTVITEVRNGLQKASLDHTVRAIVICGANDNFCAG
ADIHGFKSPTGLTLGSLVDEIQRYQKPVVAAIQGVALGGGLELALGCHYRIANAKARVGF
PEVMLGILPGARGTQLLPRVVGVPVALDLITSGRHISTDEALKLGILDVVVKSDPVEEAI
KFAQTVIGKPIEPRRILNKPVPSLPNMDSVFAEAIAKVRKQYPGRLAPETCVRSVQASVK
HPYEVAIKEEAKLFMYLRGSGQARALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGV
LGLGTMGRGIAISFARVGIPVVAVESDPKQLDTAKKIITSTLEKEASKSGQASAKPNLRF
SSSTKELSSVDLVIEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALDVDDIASSTDRP
QLVIGTHFFSPAHIMRLLEVIPSRYSSPTTIATVMSLSKRIGKIGVVVGNCYGFVGNRML
APYYNQGYFLIEEGSKPEDVDGVLEEFGFRMGPFRVSDLAGLDVGWKVRKGQGLTGPSLP
PGTPTRKRGNTRYSPIADMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSEFLSQYRE
THHIKQRSISKEEILERCLYSLINEAFRILEEGMAASPEHIDVIYLHGYGWPRHVGGPMY
YAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHSSKL
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtatctgaggctgccccactccctggctatgatccgcctctgcaatccaccg
gtcaatgccatcagtccaactgtaatcacagaagtaaggaatggactccagaaagctagt
ttggaccatacggttagagccatagtgatctgtggagcaaatgacaacttctgtgcaggt
gctgatatccatggctttaaatctcccactggccttacattaggaagcttggtagatgaa
atacagcgataccagaagccagtggtggccgccatccaaggcgtggctcttggaggagga
ctagagctggccttgggctgtcactatcggattgccaatgcaaaggctcgtgttggcttc
ccggaagtgatgctgggaattcttcctggtgcaagaggaacgcagcttctacccagggtc
gttggagttcctgttgctcttgacttaattacctcaggaagacatatttcaacagatgaa
gcactcaagcttggaattctggatgtagttgtaaagtcagacccagttgaagaagccatc
aaatttgctcagacggttataggtaaacccatagaaccccgcaggatcctaaacaagcca
gtcccaagcttgcccaacatggacagtgtttttgcagaagccattgccaaggtacggaag
cagtaccctggccgcctggctccggagacttgtgtccgttcagtccaggcctccgtgaag
catccatatgaagtggccatcaaggaagaagcaaagctgtttatgtaccttcgggggtcg
gggcaggctagagccctgcagtacgccttttttgctgaaaagtctgcaaataagtggtca
actccctcaggagcatcttggaaaacagcatctgctcaacccgtctcctcggttggtgtt
cttggcttgggaacgatgggccgaggcatcgccatctcttttgcaagggtggggatccct
gtggttgctgtagagtcagacccaaagcagctagatactgcaaagaagataataacttcc
accttggaaaaggaagcatcgaagagtggccaagcttcagcaaaaccaaacctcaggttc
tcctcatccacaaaggagctttcgagtgtggatttagtgattgaagcagtgttcgaagat
atgaacctgaagaagaaggtcttcgctgaactgtcagccctgtgcaagccgggagccttt
ctgtgcaccaatacctcagcactggatgtggatgacattgcttcttccacagatcgcccc
cagctggtgattggcacccacttcttctccccagcccacatcatgaggttactagaggtc
attcctagccgatactcttcccccactaccatcgccacagtcatgagcttatccaaaagg
attggaaagattggagtcgttgttggtaactgctatggatttgttgggaatcgaatgttg
gctccctattacaaccagggctatttcttgatagaggaaggtagtaagccagaggatgta
gatggggtcttagaagagtttggttttagaatgggacccttcagggtgtctgacctcgca
gggctagatgtgggttggaaagttcgcaaagggcaaggccttactggaccgtccttacct
ccaggaacccccacccgaaagaggggcaataccaggtactccccaattgctgatatgctc
tgtgaagctgggcgatttggtcagaagacaggtaagggctggtatcagtatgacaagcca
ctgggtcgcatccacaaacctgatccctggctttctgagtttctgtcacagtatagagaa
acccatcacatcaagcagcgctccatcagcaaggaggaaatcctggagcgttgcttatat
tcccttatcaacgaggcattccgcatcttggaggaggggatggccgctagcccagagcac
attgatgtcatctacttgcatgggtatgggtggccaaggcacgtgggtgggcccatgtac
tatgctgcctcagttgggctgcccacagttctagagaaattgcagaaatattacagacag
aatcctgacatcccccagctggagcccagtgactacctgaggaggctggttgcccaggga
agccctcctctgaaagaatggcaaagcttggcaggaccccatagcagcaaactgtga

DBGET integrated database retrieval system