KEGG   Mus musculus (mouse): 74150Help
Entry
74150             CDS       T01002                                 

Gene name
Slc35f5, 1300003P13Rik, AI646727
Definition
(RefSeq) solute carrier family 35, member F5
  KO
K15289  solute carrier family 35, member F5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    74150 (Slc35f5)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   74150 (Slc35f5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EamA
Motif
Other DBs
NCBI-GeneID: 74150
NCBI-ProteinID: NP_083063
MGI: 1921400
Ensembl: ENSMUSG00000026342
Vega: OTTMUSG00000049262
UniProt: Q8R314
Position
1; 1 E2.3
AA seq 524 aa AA seqDB search
MVPPRLHRGAGRPGGLSSLPPFGLGSARFAGIAFEDLREALATRLQMVYVFIMNRVNSQS
SGFSQRRRMALGIVILLLVDVIWVASSELTSYVFTQYNKPFFSTFAKTSMFVLYLLGFII
WKPWRQQCTRGFRGKPAAFFADAEGYFAACTTDTSMSSSLSEPLYVPVKFHDLPSEKLES
TNIGTEKTPKKSRVRFSNIMEIRQLPSSHALEAKLSRMSYPTVKDQESILKTVGKLTATQ
VAKISFFFCFVWFLANLSYQEALSDTQVAIVNILSSTSGLFTLILAAVFPSNSGDRFTLS
KLLAVILSIGGVVLVNLSGSEKSAGRDTIGSIWSLAGAMFYAVYIVMIKRKVDREDKLDI
PMFFGFVGLFNLLLLWPGFFLLHYTGFEDFEFPNKVVLLCIIINGLIGTVLSEFLWLWGC
FLTSSLIGTLALSLTIPLSIIADMCMQKVQFSWLFFAGAIPVFFSFFIVTLLCHYNNWDP
VMVGVRRVFAFICRKHRIQRVPEDSEQCESLISMHSVSQEDGAT
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggtgccgccacgactccatcgaggggcaggaaggccaggtgggctgagttctttacct
ccatttggactgggctctgcccgctttgcaggcattgcatttgaggatctcagagaagcc
cttgcaacaagactgcaaatggtttatgtgtttatcatgaaccgtgtgaattcccagagc
agtggtttcagtcagcgcaggcgaatggccctggggatagtgattctcctgctggttgat
gtgatatgggtggcatcctcagaactcacctcgtatgtcttcacgcagtacaacaagcca
ttcttcagcacctttgcgaaaacatccatgtttgttctgtaccttttgggcttcattatt
tggaagccttggaggcaacagtgtacaagaggatttagagggaagcctgctgcttttttt
gcagatgctgaaggttactttgctgcgtgcacaacagatacaagcatgagtagttctttg
agtgaacctctttatgttcctgtgaagtttcatgatctcccaagtgagaagctcgagagc
acaaacattgggaccgaaaagactcccaagaagtcccgtgtaaggttcagcaatatcatg
gagattcgccagctcccatcgagccatgcgttagaggccaagctctctcggatgtcttat
cccactgtgaaagaccaagaatccatactgaagactgtagggaaattgactgcaacccaa
gtagcaaaaattagcttttttttttgctttgtgtggtttttggcaaatttgtcataccaa
gaagcactttcagacacacaggttgccatagtgaatattttgtcttcaacttctggactt
tttactttaatccttgcagctgtatttccgagtaacagcggagacaggtttaccctctct
aaactattagctgtaattttaagcattggaggtgtggtgctggtgaacctgtctgggtct
gaaaagtctgctggaagagacacaataggttccatttggtcccttgctggagctatgttc
tatgctgtctacattgtgatgatcaagagaaaggtagacagagaagataaattggatatt
ccaatgttctttggttttgtaggtctgtttaatctgctgctcctatggccagggttcttc
ttactgcattatactggctttgaggactttgagtttcccaacaaagtggtactgttgtgt
atcattatcaacggcctcatcggaacagttctgtccgagtttctgtggttatggggctgc
tttcttacctcgtcgttgataggcacacttgcactaagccttacgatacctctctccatc
atagccgacatgtgcatgcaaaaggtgcagttttcttggttattttttgcaggcgctatc
cctgtatttttttcattttttattgttactctcctgtgccattataataattgggatcct
gtgatggtaggagtcagaagagtttttgcctttatatgcagaaaacatcgaattcagaga
gttccagaagacagtgaacagtgcgagagcctcatttctatgcacagcgtttctcaagag
gatggagctacttag

DBGET integrated database retrieval system