KEGG   Mus musculus (mouse): 74154
Entry
74154             CDS       T01002                                 

Gene name
Unkl, 1300004G08Rik
Definition
(RefSeq) unkempt family like zinc finger
  KO
K23047  E3 ubiquitin-protein ligase UNKL [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    74154 (Unkl)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     74154 (Unkl)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    74154 (Unkl)
SSDB
Motif
Pfam: zf_CCCH_5 zf-C3HC4_3 zf-CCCH Filament Golgin_A5 zf_CCCH_4 Torus Halogen_Hydrol DUF3450 GAS DUF3584 Prok-RING_4
Other DBs
NCBI-GeneID: 74154
NCBI-ProteinID: NP_001183953
MGI: 1921404
Ensembl: ENSMUSG00000015127
Vega: OTTMUSG00000035060
UniProt: Q5FWH2
Position
17; 17 A3.3
AA seq 727 aa
MPSVSKAAAAALSGSPPQTEKPTHYRYLKEFRTEQCSLFLQHKCSQHRPFTCFHWHFLNQ
RRRRPLRRRDGTFNYSPDIYCSKYDEATGLCPDGDECPYLHRTTGDTERKYHLRYYKTGT
CIHETDARGHCVKNGLHCAFAHGPLDLRPPVCDIRELQAQEALQNGQLSGGDGVPDLQPG
VLASQAMIEKILGEDPRWQDSNFVLGSYKTEQCPKPPRLCRQGYACPHYHNSRDRRRNPR
RFQYRSTPCPSVKHGDEWGEPSRCDGGDSCQYCHSRTEQQFHPEIYKSTKCNDMRQTGYC
PRGPFCAFAHTEKSLAMVNEWSCRDLSSNSTSAYSSQPGSAKRKDSPSEGSQKATEDSKQ
NHLAVFSVAHPLAHSISSSVASSLASSTGSGSSSPTTLPTLPARALPLDPAGNTVGAVIG
SALDLRLSDINIASLDKDLEEQDLGLTGPRSLAGSAPVTIPGSLPRSPSLHSSSSLSTSP
LSSLSQSLSGPLVSSAMTPPQQPPPLRSEPATLGSAASSYSSLGLNGVPGSIWDFVSGSF
SPSPSPILNSGPSASSSASPNSAELARVRRQLDEAKRKIRQWEESWQQVKQACDAWQREA
QEAKERARVADSDRQLALQRKEEVEAKVKQLQEELEGLGLSSLPGLQSLGDISDIPLPKL
HSLQSKLRLDLEAVDGVIFQLRAKQCVACQERAHGTVLRPCQHRVLCEPCAASTPECPYC
KGQPLPW
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgccgtcggtttcgaaagcggcggcggcggcgctgagcgggtcccccccgcagacagag
aaaccaacccactacaggtatctaaaggagtttaggacagagcagtgctccctgtttttg
cagcataagtgcagccagcacaggccgttcacctgtttccattggcatttcctaaatcag
cgtcgtcgcagaccgctccgacgacgcgatggcaccttcaactacagcccggacatatac
tgctccaagtacgatgaggccaccggcctgtgtcccgatggtgatgaatgcccttacctg
catcgaacaactggggacacggagcgcaagtaccacctgcgctactacaagacaggcacg
tgtattcacgagacagatgcacggggccactgtgtgaagaacgggctgcactgtgccttc
gcacacgggcccctggaccttcggccacctgtgtgtgacatcagggagcttcaggctcag
gaagccctgcagaatggccagctcagtggaggggatggtgtacctgatctgcagcctggg
gtcttggccagccaggccatgatcgagaagattcttggtgaggaccctcggtggcaagac
agtaacttcgtattgggcagctataagactgagcagtgcccgaagccaccacgcctatgt
cgccagggctacgcctgtccacactaccacaacagcagagaccgccgtcggaaccccagg
aggttccagtacaggtctacgccctgtcctagtgtgaagcacggtgacgagtggggcgag
ccctcacggtgtgacggtggggacagctgtcagtactgccattcccgcacggagcagcag
ttccatcctgagatctacaaatctacaaaatgcaacgatatgcgccaaactggctactgc
cctcggggccctttctgtgcctttgcacacactgagaagagcctggctatggtgaacgag
tggagctgccgtgatctcagttccaacagcacctcagcttatagcagccagcctggaagt
gccaaaaggaaagactccccctctgaaggaagccagaaagctactgaggacagcaagcag
aaccacctcgctgtgttctcagtggctcacccactggcccacagcataagctccagtgtg
gcatccagcctggcgtccagcactggctcgggcagctcctcccccaccacactgcctacc
ctccctgcccgtgcccttccactggatcccgccggcaacactgtgggggcagtcataggt
tctgccttagatcttcgtcttagtgacataaacatcgcgtccttagataaagacttagaa
gaacaggaccttggattgacaggtcccaggtcgctggcaggctcagcacccgtcaccatt
ccgggctccctgccccgctcgccatccttgcactcgtcctcatccctatccacctcccca
ctcagctcgctctcccagtccctgtcggggccactcgtctcctcggccatgacgcccccc
cagcagccaccacccctccggtcggagccggctacgctgggctctgcagcctcatcttac
agctctttaggtctgaacggcgttcccgggagcatctgggactttgtttctggcagcttc
tctcctagcccatcccccattctgaactccggcccttcggcttcctcaagtgcaagtcca
aacagtgctgagctggcacgggtcaggcggcagctagacgaggccaagaggaagatcagg
caatgggaagaatcttggcagcaagtgaagcaggcctgtgatgcctggcagagagaggct
caggaggccaaggaaagagcccgtgtggcagacagtgaccggcagctggccctgcagagg
aaagaagaggtggaagccaaggtgaagcagctgcaggaagaattagagggcctgggtttg
tcctcactgccagggcttcagagcttgggtgacatcagtgacatccctctccccaagctg
cattctctccagagcaagctgcgcttggacttggaggctgtggatggggtgatcttccag
ctccgtgccaaacagtgtgtggcctgccaggagcgggcccatggcactgtcctgcggccc
tgccagcaccgtgtcttatgcgaaccatgtgcggccagtacccctgagtgcccctactgc
aagggccagcccctaccatggtga

DBGET integrated database retrieval system