KEGG   Mus musculus (house mouse): 74155
Entry
74155             CDS       T01002                                 
Symbol
Errfi1, 1300002F13Rik, AI788755, Mig-6, Mig6, RALT
Name
(RefSeq) ERBB receptor feedback inhibitor 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: GTPase_binding Inhibitor_Mig-6
Other DBs
NCBI-GeneID: 74155
NCBI-ProteinID: NP_598514
MGI: 1921405
Ensembl: ENSMUSG00000028967
UniProt: Q99JZ7 Q3TK48
Position
4:150938253..150953346
AA seq 461 aa
MSTAGVAAQDIRVPLKTGFLHNGQALGNMKSCWGSHSEFENNFLNIDPITMAYNLNSPAQ
EHLTTVGCAARSAPGSGHFFAECGPSPRSSLPPLVISPSESSGQREEDQVMCGFKKLSVN
GVCTSTPPLTPIKSCPSPFPCAALCDRGSRPLPPLPISEDLCVDEADSEVELLTTSSDTD
LLLEDSAPSDFKYDAPGRRSFRGCGQINYAYFDSPTVSVADLSCASDQNRVVPDPNPPPP
QSHRRLRRSHSGPAGSFNKPAIRISSCTHRASPSSDEDKPEVPPRVPIPPRPAKPDYRRW
SAEVTSNTYSDEDRPPKVPPREPLSRSNSRTPSPKSLPSYLNGVMPPTQSFAPDPKYVSS
KALQRQSSEGSANKVPCILPIIENGKKVSSTHYYLLPERPPYLDKYEKYFKEAEETNPST
QIQPLPAACGMASATEKLASRMKIDMGSHGKRKHLSYVVSP
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtcaacagcaggagttgctgctcaggatattcgagtcccattaaaaactggatttctc
cataatggtcaggccttggggaatatgaagtcctgctggggcagtcacagtgagtttgaa
aataactttttaaatattgatccaataaccatggcctacaatctgaactcccctgctcag
gagcacctaacaactgttggatgtgctgctcggtctgctccagggagcggccacttcttt
gcagagtgtggtccatctccaaggtcaagcttgccccctcttgttatctcaccaagtgaa
agctcgggacagcgtgaagaggatcaagttatgtgtggttttaagaaactctcagtgaat
ggggtctgcacttccacacctccacttacacccattaaaagctgcccttcccctttcccc
tgtgcggctctgtgtgatcggggttctcggccgctcccgccactgcccatctctgaagac
ctatgtgtggatgaggccgacagtgaggtagagcttctaaccaccagctcagacacagac
ttgcttttagaagactctgcgccttcagatttcaaatacgatgctcctggcaggcgcagc
ttccgtgggtgcggccagatcaactatgcatattttgacagcccaactgtttctgtggca
gatcttagctgtgcatctgaccagaacagagttgttccagacccaaaccctcccccacct
caaagccatcgcagattaaggaggtctcactcaggaccagctgggtcatttaacaagcca
gccattcggatatctagctgcacacacagagcttctcctagctctgatgaagacaagcct
gaggtccctcccagggttcctatacctcctaggccagcaaagccagactatagacggtgg
tcagcagaagtgacctccaacacctacagtgatgaagataggcctcccaaagtccccccg
agagaacctttgtctcggagtaactcccgtaccccaagtcctaaaagccttccgtcttac
ctcaatggggtcatgcccccaacacagagcttcgctcctgaccccaagtatgtcagcagc
aaagccctgcagagacagagcagcgaaggatctgccaacaaggttccttgcatcctgccc
attattgaaaatgggaagaaggttagctcaacgcattattacttactacctgagaggcca
ccgtacctggacaaatatgaaaagtattttaaggaagcagaagaaacaaacccaagcacc
caaattcagccattacctgctgcctgtggtatggcctctgccacagaaaagctggcctcc
agaatgaaaatagatatgggtagccacgggaagcgcaaacacttatcctacgtggtttct
ccataa

DBGET integrated database retrieval system