KEGG   Mus musculus (mouse): 74158
Entry
74158             CDS       T01002                                 

Gene name
Josd1, 1300006C06Rik, mKIAA0063
Definition
(RefSeq) Josephin domain containing 1
  KO
K15235  josephin [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    74158 (Josd1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    74158 (Josd1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     74158 (Josd1)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C86
   74158 (Josd1)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    74158 (Josd1)
SSDB
Motif
Pfam: Josephin
Other DBs
NCBI-GeneID: 74158
NCBI-ProteinID: NP_083068
MGI: 1921408
Ensembl: ENSMUSG00000022426
UniProt: Q9DBJ6
Position
15; 15 E1
AA seq 202 aa
MSCVPWKGDKAKAESSDLPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKYHLRGK
NCELLLVVPEEVEAHQSWRADV
NT seq 609 nt   +upstreamnt  +downstreamnt
atgagttgcgtgccatggaaaggagacaaggccaaagctgaatcctcggaccttccccaa
gcagcgcccccacaaatctaccatgagaagcagcgcagggagctctgtgctcttcatgct
ctcaacaacgtcttccaggacagcaacgccttcacgcgggaaacgctgcaggagattttc
cagaggctgtctccgaacactatggtgacgccccacaagaagagcatgctgggaaatggg
aactatgatgtgaatgtcatcatggcagcacttcaaaccaaaggctatgaagctgtttgg
tgggacaagcgaagggacgtgggtgtcattgctcttactaatgtcatgggcttcatcatg
aacctgccctccagcctctgctggggtccactcaagttgcctctcaaaagacagcactgg
atctgtgttcgtgaggtgggaggggcctactacaaccttgactccaaactcaagatgcca
gagtggattggaggcgagagtgagctcaggaaatttctaaaataccatttgcgaggtaaa
aactgtgaactcctactggttgtaccggaagaagtggaagcccatcagagctggagggcc
gacgtgtga

DBGET integrated database retrieval system