KEGG   Mus musculus (house mouse): 74167
Entry
74167             CDS       T01002                                 
Symbol
Nudt9, 1190002C07Rik, ADPR-PPase, AI462474
Name
(RefSeq) nudix (nucleoside diphosphate linked moiety X)-type motif 9
  KO
K13988  ADP-ribose pyrophosphatase [EC:3.6.1.13]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    74167 (Nudt9)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     74167 (Nudt9)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 74167
NCBI-ProteinID: NP_083070
MGI: 1921417
Ensembl: ENSMUSG00000029310
UniProt: Q8BVU5
Position
5:104193407..104213244
AA seq 350 aa
MAGRSLGQAVATVSLSVALASVTVRSSACRAVPAPRNTFPTCGFHLNANIMSGSNGAKEN
SHNKARTSPYPGSKVERSQVPNEKVGWLVEWQDYNPVEYTAVSVLAGPQWADPQISESNF
SPKFNEKDGHVERKSQNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKR
DESGNKITHPVSGKCILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQ
KSSAEKREIEEKLHALFSQEHLVIYKGYVDDPRNTDNAWMETEAVNYHDETGETMDNLTL
EAGDDAGKVKWVDISDQLKLYASHSQFIKLVAEKRDAHWSEDHAADSRGL
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggccggccgctccctggggcaggcggtagccaccgtgtcgctctcggtggccctcgcg
tcagtgactgtccggtcctcagcctgccgcgccgtccccgcacccagaaacacatttcca
acctgtgggttccaccttaacgccaacatcatgtctggttctaatggtgccaaagagaat
tcccacaacaaggcccggacttctccttacccaggttcaaaagtcgagcgaagtcaggtt
ccgaatgagaaggtgggctggctcgttgagtggcaggactacaacccagtggagtacacc
gcggtctctgtcctggctggaccccagtgggcggaccctcagatcagtgaaagcaacttc
tctcccaagtttaatgaaaaggacgggcatgttgagagaaagagccagaatggcctgtat
gagattgaaaacggaagacccagaaaccctgcagggaggacaggactggttggccggggt
cttctggggagatggggcccaaatcatgccgcagatcctattataaccaggtggaaaagg
gacgagagcgggaataagatcacacaccctgtctctgggaaatgcatcttgcagttcgtt
gccatcaagaggaaagactgtggagagtgggcaatcccgggggggatggtggaccccgga
gagaagatcagtgccaccctgaaaagggagtttggtgaagaagccctgaactcgttacag
aagtccagtgccgagaagagagagatcgaggagaaactgcacgcgctcttcagccaagag
catctcgtgatatataaggggtatgttgacgaccctcggaacactgacaatgcgtggatg
gagacggaagccgtgaactaccatgatgaaacaggggagaccatggacaacctcaccctg
gaggccggagatgacgcagggaaggtgaagtgggtggacatcagcgaccagctcaagttg
tacgccagtcactctcagttcatcaaactcgtggcagagaaacgagatgcccactggagc
gaggaccacgccgctgacagccgtgggctatag

DBGET integrated database retrieval system