KEGG   Mus musculus (mouse): 74168
Entry
74168             CDS       T01002                                 

Gene name
Zdhhc16, 1500015N03Rik, AP, Aph2
Definition
(RefSeq) zinc finger, DHHC domain containing 16
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    74168 (Zdhhc16)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     74168 (Zdhhc16)
Motif
Pfam: DHHC
Other DBs
NCBI-GeneID: 74168
NCBI-ProteinID: NP_076229
MGI: 1921418
Ensembl: ENSMUSG00000025157
UniProt: Q9ESG8
Position
19; 19 C3
AA seq 361 aa
MRGQRSLLLGPARLCLRLLLLLGYRRRCPPLLRGLVQRWRYGKVCLRSLLYNSFGGSDTA
VDAAFEPVYWLVDNVIRWFGVVFVVLVIVLTGSIVAIAYLCVLPLILRTYSVPRLCWHFF
YSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKCIYPKPARTHHCSICNRCVLK
MDHHCPWLNNCVGHYNHRYFFSFCFFMTLGCVYCSYGSWDLFREAYAAIETYHQTPPPTF
SFRERITHKSLVYLWFLCSSVALALGALTMWHAVLISRGETSIERHINKKERRRLQAKGR
VFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMSWDPPPWVTAHSASVMA
V
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgcgaggccagcgaagtctgctgttggggccagcccgcctctgcctgcgcctccttttg
ctcctgggctaccggcgtcgatgcccacctctgctccggggcctggtacagcgctggcgt
tatggcaaggtttgcctgcgctccctgctctacaattcctttggaggcagtgacactgcc
gttgatgctgcctttgagcctgtctactggctggtggacaatgtgatccgctggtttgga
gtggtgtttgtggtgctggtgatcgtgctgaccgggtccatcgtggccattgcttatctg
tgtgtcctgcccctcatcctccgaacctactcggtaccacggctctgctggcatttcttc
tatagtcactggaatctgatcctcatcgtcttccattactaccaggccatcaccactcct
cctggatacccaccccagggcaggaatgacattgctactgtctccatctgtaagaagtgc
atttatcccaagccagcccgaacacaccactgcagcatctgtaataggtgtgtgctgaag
atggatcatcactgcccctggctaaacaactgtgtgggccactataaccatcgctacttc
ttctctttctgctttttcatgactctgggctgtgtctactgtagctatggaagttgggac
cttttccgggaggcttatgctgccattgagacgtaccaccagactccaccacctaccttc
tcctttcgagaaaggataactcacaagagtcttgtctacctctggttcctgtgcagttct
gtggccctggccctgggtgccctaaccatgtggcatgctgttctcatcagtcggggtgag
actagcatcgaaaggcatatcaacaagaaggagaggcgccggttacaggccaagggcagg
gtgtttaggaatccttacaactatggctgcttggacaactggaaggtgttcctaggtgtg
gacacaggaaggcattggctgacccgggtgctgttaccttctagtcacctgccccatggg
aatgggatgagctgggaccctcctccctgggtgactgctcactcagcctctgtgatggcc
gtgtaa

DBGET integrated database retrieval system