KEGG   Mus musculus (mouse): 74182
Entry
74182             CDS       T01002                                 

Gene name
Gpcpd1, 2310004G06Rik, 2310032D16Rik, AU015213, Gde5, Prei4, mKIAA1434
Definition
(RefSeq) glycerophosphocholine phosphodiesterase 1
  KO
K18695  glycerophosphocholine phosphodiesterase GPCPD1 [EC:3.1.4.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    74182 (Gpcpd1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    74182 (Gpcpd1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.2  glycerophosphocholine phosphodiesterase
     74182 (Gpcpd1)
SSDB
Motif
Pfam: GDPD CBM_20 PI-PLC-X
Other DBs
NCBI-GeneID: 74182
NCBI-ProteinID: NP_083078
MGI: 104898
Ensembl: ENSMUSG00000027346
Vega: OTTMUSG00000015660
UniProt: Q8C0L9
Position
2 F2; 2
AA seq 675 aa
MTPSQVTFEIRGTLLPGEVFAICGSCDALGNWNPQNAVALINENETGDSVLWKAVIALNR
GVSVKYRYFRGCFLEPKTIGGPCQVIVHKWETHLQPRSITPLESEIIIDDGQFGIHNGVE
TLDSGWLTCQTEIRLRLHFSEKPPVSISKKKFKKSRFRVKLTLEGLEEDEDDDDDKVSPT
VLHKMSNSLEISLISDNEFKCRHSQPECGYGLQPDRWTEYSIQTMEPDNLELIFDFFEED
LSEHVVQGDVLPGHVGTACLLSSTIAESGRSAGILTLPIMSRNSRKTIGKVRVDFIIIKP
LPGYSCSMQSSFSKYWKPRIPLDVGHRGAGNSTTTAKLAKVQENTIASLRNAASHGAAFV
EFDVHLSKDFVPVVYHDLTCCLTMKRKYEADPVELFEIPVKELTFDQLQLLKLSHVTALK
TKDRKQSLYEEENFFSENQPFPSLKMVLESLPENVGFNIEIKWICQHRDGVWDGNLSTYF
DMNVFLDIILKTVLENSGKRRIVFSSFDADICTMVRQKQNKYPILFLTQGKSDIYPELMD
LRSRTTPIAMSFAQFENILGINAHTEDLLRNPSYVQEAKAKGLVIFCWGDDTNDPENRRK
LKEFGVNGLIYDRIYDWMPEQPNIFQVEQLERLKQELPELKNCLCPTVSHFIPSSFCVEP
DIHVDANGIDSVENA
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgacaccttctcaggtcacttttgaaataagaggaactcttttaccaggagaggtcttt
gcaatatgtggaagctgtgatgccctgggaaactggaatcctcaaaatgctgtggctctt
attaatgaaaacgagacaggagacagtgtgttgtggaaagcagtgattgctctcaataga
ggagtgtcagtgaagtaccgctacttcagaggctgctttttagaaccaaagactatcggt
ggtccatgtcaagtcatagttcacaagtgggagactcatctacaaccacgatcaataacc
cctttagaaagtgaaatcattattgacgatggacagtttggcatccacaatggtgttgaa
acactggattctggatggcttacatgtcagactgaaataagattgcgtctgcatttttct
gagaaacctcctgtttcaattagcaagaaaaagttcaaaaaatcgagatttagggtaaag
ctcacactcgagggtctggaggaagatgaagatgatgatgacgataaggtctctcccact
gttcttcacaaaatgtccaacagcctggagatatccttaataagtgacaatgagttcaag
tgcaggcactcacagccagaatgtgggtatggcttacagcccgatcgttggacagagtac
agcatacagacaatggaaccagataatctggagctcatctttgacttttttgaggaagat
ctcagtgagcatgtagttcagggtgatgttcttcctggacacgtgggcacagcatgcctc
ctgtcttctaccattgctgagagtggaagaagcgctggaatccttactcttcccatcatg
agcagaaattccagaaaaactataggcaaagtcagagttgattttatcatcatcaagcca
ttacctggatatagttgttctatgcagtcttcattttccaagtattggaaaccaagaata
ccattggacgttggacatcgtggtgcagggaactcaacaacgactgccaagctagctaaa
gtacaggaaaatactatcgcttctttaagaaatgctgccagtcatggcgcagcatttgta
gaatttgatgtccacctttcaaaggactttgtgcccgtggtgtatcatgacctcacctgc
tgtctgaccatgaagaggaaatatgaagctgatccagttgaattgtttgaaatcccagta
aaagaattaacatttgaccaactccagttattgaagctttctcatgtgactgcattaaaa
accaaagaccggaaacaatctttgtatgaggaggaaaatttcttttctgaaaatcagcca
tttccttctcttaagatggttttagaatcattgccagaaaatgtaggatttaatatagaa
ataaaatggatttgccaacacagggatggagtatgggatggcaacttatcaacatatttt
gatatgaatgtgtttttggatataattttaaaaactgttttagaaaattctgggaagagg
agaatagtgttttcttcttttgatgcagatatttgtacaatggttcggcagaagcagaac
aaatatcccatattatttttgacccaaggaaagtctgatatttaccccgaactcatggac
ctcagatctcggacaacacccattgcaatgagttttgcacagtttgaaaatattttgggg
ataaatgcccatactgaagacctccttagaaacccatcctatgtccaagaggcaaaagct
aagggattggtcatattctgctggggtgatgataccaacgatcctgaaaacagaaggaaa
ctgaaggaatttggagtaaatggtctaatatatgataggatatatgattggatgcctgaa
cagccaaatatattccaagtggagcagttggagcgcctgaagcaagaattgccagagctt
aagaactgtttgtgtcccactgttagccacttcatcccttcttctttctgtgtggagcct
gatatccacgtggatgccaacggcattgatagtgtggagaacgcttag

DBGET integrated database retrieval system