KEGG   Mus musculus (house mouse): 74185
Entry
74185             CDS       T01002                                 
Symbol
Gbe1, 2310045H19Rik, 2810426P10Rik, D16Ertd536e
Name
(RefSeq) glucan (1,4-alpha-), branching enzyme 1
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
Module
mmu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    74185 (Gbe1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    74185 (Gbe1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     74185 (Gbe1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   74185 (Gbe1)
SSDB
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase hDGE_amylase DUF5696
Other DBs
NCBI-GeneID: 74185
NCBI-ProteinID: NP_083079
MGI: 1921435
Ensembl: ENSMUSG00000022707
UniProt: Q9D6Y9
Position
16:70110837..70366608
AA seq 702 aa
MAAPAAPAAGETGPDARLEAALADVPELARLLEIDPYLKPFAADFQRRYKKFSQVLHDIG
ENEGGIDKFSRGYESFGIHRCSDGGIYCKEWAPGAEGVFLTGEFSGWNPFSHPYKKLEYG
KWELYIPPKQNKSPLIPHGSKLKVVITSKSGEILYRISPWAKYVVRENNNVNYDWIHWAP
EDPYKFKHSRPKKPRSLRIYESHVGISSHEGKIASYKHFTSNVLPRIKDLGYNCIQLMAI
MEHAYYASFGYQITSFFAASSRYGTPEELKELVDTAHSMGIVVLLDVVHSHASKNSEDGL
NMFDGTDSCYFHSGPRGTHDLWDSRLFIYSSWEVLRFLLSNIRWWLEEYCFDGFRFDGVT
SMLYHHHGMGQGFSGDYNEYFGLQVDEDALIYLMLANHLAHTLYPDSITIAEDVSGMPAL
CSPTSQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGNIVYTLTNRRYLEKCVAYAESH
DQALVGDKTLAFWLMDAEMYTNMSVLAPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMG
NEFGHPEWLDFPRKGNNESYHYARRQFNLTDDDLLRYKFLNNFDRDMNRLEERCGWLSAP
QAYVSEKHEANKTITFERAGLLFIFNFHPSKSYTDYRVGTATPGKFKIVLDSDAAEYGGH
QRLDHNTNYFAEAFEHNGRPYSLLVYIPSRVALILQNVDLQN
NT seq 2109 nt   +upstreamnt  +downstreamnt
atggcggcgccggcggctcctgcggcaggggaaacgggccccgatgctcgtctggaggcc
gccttggccgacgtgccggagctggcccgactcctggagattgacccgtacctgaagccc
ttcgccgcggacttccagcgcaggtataagaagtttagccaggttttgcatgacattgga
gagaatgaaggtgggatcgataagttctccagaggctatgagtcatttggcatccacaga
tgttctgatggtggcatctactgcaaagaatgggccccaggagcagaaggagtttttctt
actggagaattcagtggttggaatccattttctcacccatataaaaagctggaatacgga
aaatgggagctgtatatcccacccaagcagaacaaatcccccctgatacctcatgggtcc
aagctgaaggtagttattactagtaagagtggcgagatactgtatcgcatttccccatgg
gcaaagtatgtggttcgtgagaacaacaacgtgaactatgattggatacactgggctcca
gaagacccctataaattcaagcattccagacctaagaaaccaagaagcctaagaatttat
gaatctcatgtgggaatttcttcccacgaaggaaaaatagcttcttacaaacattttacc
agcaatgtactaccaagaatcaaagaccttgggtataactgcattcagttgatggcgatc
atggaacatgcttactatgccagttttgggtaccaaatcacgagcttttttgcagcttca
agtcgttatggaactcctgaagagctgaaagaacttgttgacacagcacattcgatgggc
attgtagtcctcctagatgtggttcatagccatgcttcaaaaaattcagaagatgggtta
aacatgtttgatgggaccgattcctgttattttcactctggaccccgagggacccatgat
ctttgggacagtagattatttatctattccagctgggaagttttaagattccttctgtcg
aacataagatggtggttggaggagtactgctttgatggcttccgttttgatggtgtcacc
tctatgctctatcatcaccacggaatgggtcaaggtttttcgggtgactataatgaatat
tttggactacaagtagatgaagatgctttgatttatctcatgttggcaaatcatttggct
cacacgttgtacccagactcgataacaatagcagaggatgtatcagggatgccggctctc
tgttctccaacttcccagggaggcggtggttttgactacagattagcaatggctattcca
gataaatggatccaattacttaaggaatttaaagatgaagactggaatatgggcaatata
gtgtatactctcaccaatcgacgctaccttgaaaaatgtgtggcttatgcagagagtcat
gatcaggcattggttggtgacaagacactggcgttttggttgatggacgctgagatgtac
acgaacatgagcgttctggcccctttcactccagtaattgatcgaggaatacagcttcat
aagatgattcgtctcatcactcacgggctcggtggagaaggctatctcaatttcatgggt
aatgagtttgggcatcctgaatggttggacttcccaaggaaaggaaataatgagagttac
cattatgccagaaggcagtttaatttaaccgacgatgaccttcttcgctataagttccta
aataactttgacagagatatgaatagactggaagaaagatgtggttggctttcagctcca
caggcctacgtgagtgaaaaacatgaagccaataagacaatcacctttgagagagcagga
cttctctttattttcaacttccacccaagcaagagctatacggactaccgagtcgggaca
gcaacaccagggaagttcaaaattgtactagattctgacgcagcggagtatggaggtcat
cagagactggaccacaacaccaactactttgctgaggcttttgaacataatgggcgcccc
tattctcttctggtgtacattccaagccgagtggctctcatccttcagaatgtggatctg
caaaactga

DBGET integrated database retrieval system