KEGG   Mus musculus (mouse): 74187
Entry
74187             CDS       T01002                                 

Symbol
Katnb1, 2410003J24Rik, KA, KAT
Name
(RefSeq) katanin p80 (WD40-containing) subunit B 1
  KO
K18643  katanin p80 WD40 repeat-containing subunit B1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    74187 (Katnb1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Katanin
     74187 (Katnb1)
SSDB
Motif
Pfam: Katanin_con80 WD40 ANAPC4_WD40 eIF2A Ge1_WD40
Other DBs
NCBI-GeneID: 74187
NCBI-ProteinID: NP_083081
MGI: 1921437
Ensembl: ENSMUSG00000031787
Vega: OTTMUSG00000061713
UniProt: Q8BG40
Structure
PDB: 
5LB7 5OW5 6GZC 5NBT

Position
8; 8 C5
AA seq 658 aa
MATPVVTKTAWKLQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLT
GHTSPVESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFV
ASGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGK
MMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFN
PDGCCLYSGCQDSLRVYGWEPERCFDVVLVNWGKVADLAICNDQLIGVAFSQSNVSSYVV
DLTRVTRTGTVTQDPVQANQPLTQQTPNPGVSLRRIYERPSTTCSKPQRVKHNSESERRS
PSSEDDRDERESRAEIQNAEDYNEIFQPKNSISRTPPRRSEPFPAPPEDDAATVKEVSKP
SPAMDVQLPQLPVPNLEVPARPSVMTSTPAPKGEPDIIPATRNEPIGLKASDFLPAVKVP
QQAELVDEDAMSQIRKGHDTMFVVLTSRHKNLDTVRAVWTTGDIKTSVDSAVAINDLSVV
VDLLNIVNQKASLWKLDLCTTVLPQIEKLLQSKYESYVQTGCTSLKLILQRFLPLITDIL
AAPPSVGVDISREERLHKCRLCFKQLKSISGLVKSKSGLSGRHGSAFRELHLLMASLD
NT seq 1977 nt   +upstreamnt  +downstreamnt
atggccacccctgtggtcaccaagacagcctggaagttgcaagagatcgtcgcccatgcc
agcaatgtgtcctccttggtgctgggcaaggcctcagggcggctgctggccactggtggg
gatgactgccgagtcaacctgtggtccataaacaagcctaactgcatcatgagcctgaca
ggtcacacgtcccctgtggagagtgtccgtctcaacactcctgaggagctcatcgtagct
ggttcccagtcgggctccatccgcgtctgggacctggaagctgctaaaattcttcgaaca
ctcatgggccacaaagccaacatctgcagcctggatttccacccctatggtgaatttgtg
gcctcaggctcccaggacacaaacattaagctctgggacatcaggaggaaaggctgtgtc
ttccgatatagggggcacagccaggctgtgcggtgtctccggttcagccctgatgggaag
tggctggcgtcggcagcagatgaccacacagtgaagctttgggatctgacggctggcaag
atgatgtccgagttcccgggtcatacagggcctgtcaatgtggtggagtttcaccccaat
gaatatctcctagcttctggcagctccgacaggacaatccgcttctgggacctggagaag
ttccaggtggtgagctgcattgaaggggagcccgggcccgtcaggagtgtcctcttcaac
cccgacggctgctgcttgtacagcggctgccaggactcgctgcgtgtctacggctgggaa
cctgagcgctgctttgatgtggtccttgtcaactggggcaaggtggctgacctggccatc
tgcaatgaccagctgataggtgtggctttctcccagagtaatgtctcctcttatgtggtg
gacctgacgagagtcaccaggacgggaactgtgacccaggaccctgtgcaggctaaccag
cctctgacacaacagacccctaaccctggtgtctccctccgccgcatctatgagcggccc
agcacgacatgcagcaagcctcagagggtaaagcacaactcagagagcgagcggcgcagc
cccagcagcgaagatgacagggacgagcgagagtcccgggcggagatccagaacgcggag
gactacaatgagattttccagcccaagaacagcatcagtcggacaccaccccggagaagt
gagcccttcccagcacccccagaagatgatgcagccacagtgaaggaggtctcaaaaccc
agcccagccatggatgtgcagttgccgcagttgccggtgccaaatctcgaggtcccagca
cgaccgtcagtcatgacttccactcctgcacccaagggtgaacctgacatcatccctgcc
acacggaatgagcccattggcttaaaggcctcggacttcttgcccgccgtgaaggtcccc
cagcaggcagagctggtggacgaggatgccatgtcgcagatacgcaaaggccacgacacc
atgtttgtggtgctcaccagccgccacaagaacctggacactgtccgagctgtatggact
acaggagatatcaagacatcagtggactctgcagtggccatcaatgacctgtctgtggta
gtggacctcctgaacattgtcaatcagaaagcctccctgtggaagctggacctgtgcacc
acagtgctgccccagatcgagaaactgctgcagagcaagtatgagagctatgtccagacc
gggtgcacctccctgaagctgatcctgcagcggttcctacccctcatcactgacattttg
gcagccccgccctctgtgggtgtggacatcagccgagaggagaggttgcacaagtgtcga
ctctgcttcaaacaactcaagagcatcagtggcctcgtcaagagcaagtcgggtttgagt
ggccgccatggcagtgccttccgtgagctgcacctactcatggccagtttggactga

DBGET integrated database retrieval system