KEGG   Mus musculus (mouse): 74191
Entry
74191             CDS       T01002                                 

Gene name
P2ry13, 2010001L06Rik, GPCR1, GPR94, Gpr, Gpr86, P2Y1, P2Y13, P2yr13, SP1, SP174
Definition
(RefSeq) purinergic receptor P2Y, G-protein coupled 13
  KO
K08388  P2Y purinoceptor 13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    74191 (P2ry13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    74191 (P2ry13)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    74191 (P2ry13)
SSDB
Motif
Pfam: 7tm_1 DUF373
Other DBs
NCBI-GeneID: 74191
NCBI-ProteinID: NP_083084
MGI: 1921441
Ensembl: ENSMUSG00000036362
Vega: OTTMUSG00000052358
UniProt: Q9D8I2
Position
3; 3 D
AA seq 337 aa
MLGTINTTGMQGFNKSERCPRDTRMTQLLFPVLYTVVFLAGILLNTVALWVFVHIPSNST
FIVYLKNTLVADLIMALMLPFKILSDSHLAPWQLRGFVCTLSSVVFYETMYVGIMMLGLI
AFDRFLKIIMPFRKTFVKKTAFAKTVSISVWSLMFFISLPNMILNKEATPSSVKKCASLK
SPLGLWWHQVVSHTCQFIFWAVFILMLLFYAVITKKVYNSYRKFRSKDSRHKRLEVKVFI
VMAVFFVCFAPLHFVRIPYTYSQTTNKTDCRLENQLFIAKEATLFLATTNICMDPLIYII
LCKKFTQKVPCVRWGKARTAGSSEDHHSSQTDNITLA
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgctcgggacaatcaacaccactgggatgcagggcttcaacaagtctgagcggtgcccc
agggacactcggatgacacagctgctgttcccggttctctatactgtggtcttcctggca
ggcatcctgctgaacaccgtggccctctgggtgttcgtccacatccccagcaattccacc
tttatcgtctacctcaagaacactctggtggcagacttgataatggcactcatgctgcct
ttcaaaatcctttccgactcacaccttgcgccctggcagctccgaggatttgtgtgcacg
ctctcctccgtggtcttctatgagacgatgtatgtgggtatcatgatgctgggcctcatc
gctttcgacaggttcctcaagatcatcatgccgttcaggaaaacctttgtcaaaaagacg
gctttcgcaaaaacagtctccatttccgtctggtccctgatgttcttcatctccctgcca
aacatgatcttgaacaaggaggcaacgccatcatccgtgaagaagtgtgcatctttgaag
agtccccttgggctgtggtggcatcaggtggtcagtcacacctgccagttcattttctgg
gctgtgtttattctgatgcttctgttttatgcggtgattaccaaaaaggtgtacaactcc
tataggaagtttaggagtaaggacagcaggcacaagcggctggaggtgaaggtatttatc
gtcatggctgtcttctttgtctgctttgccccactgcattttgtcagaataccatacact
tacagtcaaaccaccaataagactgactgtaggttagaaaaccagctgtttattgctaaa
gaagcaactctctttctggcaacaactaacatttgtatggaccccttaatatacataatt
ttatgcaagaagttcacacaaaaggtgccatgtgtgagatggggaaaggcaagaacagca
ggatcaagcgaagaccaccacagtagtcagacagacaacatcaccctagcctga

DBGET integrated database retrieval system