KEGG   Mus musculus (house mouse): 74195
Entry
74195             CDS       T01002                                 
Symbol
Elp3, 2610507P14Rik, KAT9
Name
(RefSeq) elongator acetyltransferase complex subunit 3
  KO
K07739  elongator complex protein 3 (tRNA uridine(34) acetyltransferase) [EC:2.3.1.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    74195 (Elp3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-
     74195 (Elp3)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA modification factors
   Elongator complex
    74195 (Elp3)
SSDB
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Other DBs
NCBI-GeneID: 74195
NCBI-ProteinID: NP_083087
MGI: 1921445
Ensembl: ENSMUSG00000022031
UniProt: Q9CZX0
Position
14:complement(65767895..65830561)
AA seq 547 aa
MRQKRKGDLSPAELMMLTIGDVIKQLVEAHEQGKDVDLNKMKTKTAAKYGLASQPRLVDI
IAAVPPHYRKILIPKLKAKPVRTASGIAVVAVMCKPHRCPHISFTGNICIYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEE
YRDYFIRSLHDALSGHTSNNIHEAIKYSERSFTKCVGITIETRPDYCMKRHLSDMLTYGC
TRLEIGVQSVYEDVARDTNRGHTVKAACESFHLAKDSGFKVVTHMMPDLPNVGLERDIEQ
FIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYRSYSPSDLIELVARILALVPPWT
RVYRVQRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHHRVRPYQV
ELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELGGGVSIVRELHVYGS
VVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKMAVISGVGTRNYYRKIGYRLQGP
YMVKMLK
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgaggcaaaagaggaaaggggacctcagcccggctgagctgatgatgctgactatagga
gacgttatcaagcagctggttgaagctcatgagcaggggaaagacgtcgatctaaataag
atgaaaaccaagacagctgccaagtatggccttgcgtcccagccccgcctggtggatatc
atcgctgcagtccctcctcactatcgaaagatcttgattcctaagctaaaggcgaagccc
gtcaggactgccagtgggatcgctgttgtggctgtgatgtgcaaaccccacagatgtcca
cacatcagtttcacagggaatatatgtatatactgccccggaggacctgactccgatttt
gagtattcaacccagtcttacacgggctatgagccaacttccatgagagctatccgtgct
agatatgacccttttctgcagacaagacaccggatagagcagctaaagcagcttggtcac
agtgtggataaggtggagttcatcgtgatgggtggaacgttcatggcccttccagaagag
tacagagattatttcatccgaagtttacacgatgctttatcaggccatacttcaaacaat
attcacgaggcaatcaagtattctgagagaagcttcacaaagtgtgttggaattacaatt
gagaccagacctgattattgcatgaagcggcacctaagtgacatgttgacttatggctgc
acaaggctggagatcggagtgcagagtgtctatgaagatgtggccagagataccaacagg
ggccatactgtgaaggcagcgtgtgaatctttccacctggccaaagattctggtttcaaa
gtggtgacgcatatgatgcctgacctgccgaacgtgggactggagagagacattgagcag
tttatagaatttttcgagaaccctgcttttcgtcctgatggtttgaagctctacccaacc
ctggttatccgtggaactggtctgtatgagctgtggaaatcaggaaggtacaggagctat
tctcccagtgacctgattgagctggtggctcggatcctagcccttgtgcccccgtggact
cgtgtgtaccgggtgcagagagacatcccaatgccccttgtcagctcaggagtggagcat
ggcaacctgcgcgagctggcatttgcaagaatgaaggatcttggaatacagtgccgtgat
gtgagaaccagggaggttggaatccaagaaattcatcacagagtgcggccataccaggtc
gagttggtacggagagattatgttgccaatggtggctgggaaactttcctgtcctacgaa
gatcctgatcaggacattctgattggcctcctaaggctgcggaagtgctctgaggaaacc
ttccggtttgaactgggtggaggtgtttccatagtccgagagctacacgtgtatggaagt
gtggtccctgtgagcagccgggatcccactaaatttcagcatcaggggttcggcatgctg
ctgatggaagaggcagagagaatcgctcgggaagagcatggatctgggaaaatggcagtt
atatcaggggtcggcacaagaaattattaccgaaagattggctacagattacaaggcccc
tacatggtaaagatgctaaaataa

DBGET integrated database retrieval system