KEGG   Mus musculus (mouse): 74221
Entry
74221             CDS       T01002                                 

Gene name
Tex37, 1700011F03Rik, Tsc21
Definition
(RefSeq) testis expressed 37
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: TSC21
Other DBs
NCBI-GeneID: 74221
NCBI-ProteinID: NP_083101
MGI: 1921471
Ensembl: ENSMUSG00000051896
Vega: OTTMUSG00000024472
UniProt: Q9DAG4
Position
6; 6 C1
AA seq 180 aa
MARVVRPQKNHVDLDIYQSSYMVDYKPFGKYKYSRVTPQEQAKLDAQLQSKEFYQPKPNP
NPKLEEGYPAFRRPYMTALDLGVPGFFPPQERVTTRKDDGRFTTTCHYAYPASLALYLAQ
QDPYWLHQRADFPCLMEPERQPAPEVGKGYLLLPGCLCDHHQRVKVPILNRWGPLMPFYQ
NT seq 543 nt   +upstreamnt  +downstreamnt
atggcacgtgtggtgagaccccaaaagaaccacgtggacctagatatataccaaagctca
tacatggtggactataagccctttgggaagtacaaatattctagagtcacgccacaagag
caggccaagcttgacgctcagctccagagcaaagagttttaccagcccaagcccaacccc
aaccccaagctggaggaaggctatcctgctttcagaagaccctacatgactgccctagac
ttgggagtccctggcttcttcccgccacaagaacgggtaactactaggaaggatgacggc
aggtttaccaccacctgccattatgcttacccagcatccctggcgctgtacctggcccag
caagacccctactggcttcaccagagggccgacttcccatgcctcatggaaccggagcgg
cagcctgctccagaagtgggcaaaggctaccttctactccctggctgtctctgtgaccat
caccagagagtcaaggtccccatcttgaataggtggggccccttgatgccattttaccag
tag

DBGET integrated database retrieval system