KEGG   Mus musculus (mouse): 74237
Entry
74237             CDS       T01002                                 

Gene name
Tubgcp2, 1700022B05Rik
Definition
(RefSeq) tubulin, gamma complex associated protein 2
  KO
K16569  gamma-tubulin complex component 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    74237 (Tubgcp2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    74237 (Tubgcp2)
   04147 Exosome [BR:mmu04147]
    74237 (Tubgcp2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     74237 (Tubgcp2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Gamma-tubulin complex components
     74237 (Tubgcp2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   74237 (Tubgcp2)
SSDB
Motif
Pfam: GCP_C_terminal GCP_N_terminal zf-Tim10_DDP
Other DBs
NCBI-GeneID: 74237
NCBI-ProteinID: NP_001272936
MGI: 1921487
Ensembl: ENSMUSG00000025474
Vega: OTTMUSG00000060571
UniProt: Q921G8 Q3UIT6
Position
7; 7 F4
AA seq 905 aa
MSEFRIHHDVNELLSLLRIHGGDGAEVYIDLLQKNRTPYVTTTVSAHSAKVKIAEFSRTP
EDFLKKYDELKSKNTRNLDPLVYLLSKLTEDKETLQFLQQNAKERAELAASAATSNTTSF
SIPVAASKMSTQELEELRKQLGSVSTGSTLQQSLELTRKMLRDKQNKKNSGQPLPVFPAW
VYERPTLAGDFLIGSGLSSDTVLPIGTLPLASQESAVVEDLLYVLVGVDGRYITAQPLAG
RQNRTFLVDPNLDLSIRELVNRILPVAASYSTVTRFIEEKSSFEYGQVNHALAAAMRTLV
KEYLILVTQLEQLHRQGLLSLQKLWFYIQPAMRTIDILASLATSVDKGECVGGSTLSLLH
DRSFNYTGDSQAQELCLYLTKAASAPYFEILEKWIYRGIIHDPYSEFMVEEHELRKEKIQ
EDYNDKYWDQRYTVLPQQIPSFLQKVAGKILSTGKYLNVVRECGHDVTCPVAKEIIYTLK
ERAYVEQIEKAFNYASKVLLDFLMEEKELVAHLRSIKRYFLMDQGDFFVHFMDLTEEELR
KPVEDIILTRLEALLELALRMSTANTDPFKDDLKIELMPHDLITQLLRVLAIETKQEKAM
THADPTELTLSGLEAFSFDYMVKWPLSLIINRKALTRYQMLFRHMFYCKHVERQLCSVWI
SNKTAKQHALHSAKWFAGAFTLRQRMLNFVQNIQYYMMFEVMEPTWHILEKNLKSASNID
DVLGHHTSFLDNCLKDCMLTNPELLKVFSKLMSVCVMFTNCMQKFTQSMKLDSELGRLTL
DQGSVQGPPTETERIEDRPRKELTRKHLSEHVDAPQLASGFEATINNFDKNFSAHLLDLL
ARLSVYSTSDCEHGMASVISRLDFNGFYAERLERLSAERSQKAAPQVPVPRGPSAPAPRV
AIPAQ
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgagcgaatttcggattcaccatgatgtcaatgagctgctcagcctgctccgcatccat
ggcggggatggggctgaggtctacattgacctgctgcagaagaaccggacgccgtatgtc
acaaccacagtctctgcccacagtgccaaggtcaaaattgcagaattttctcgaactcct
gaggactttttaaagaaatatgatgaactgaaatctaaaaatacaaggaaccttgaccca
ctggtgtacctgttatcaaaactcacagaagacaaagagacacttcagtttttgcaacag
aatgcaaaggaaagagctgagcttgcagctagtgctgcaactagcaacaccaccagcttc
agcatccctgttgcagcctctaagatgtccacacaagagctagaggaactgaggaagcag
cttggcagtgtatccacaggctccacactgcagcagtctctggaacttacaagaaagatg
cttcgagacaaacagaacaaaaaaaattcaggccagcccctccctgtcttcccagcatgg
gtgtatgagagaccaacattggctggagatttcctgattggctcgggcttgagctcagac
acagttttgcctataggtacattgcccttggcctcccaggagtcagctgtggtggaagat
ctgctctatgtgcttgtgggtgtggatggcaggtatatcactgctcagcctttggctggg
aggcagaaccgtaccttccttgtcgaccccaacctggacctgtccatccgggagctagta
aacagaatcctccctgtggccgccagctactctactgtgaccaggttcattgaggagaag
tcttcatttgaatatgggcaggtgaaccatgccctggctgctgccatgagaaccctagta
aaggaatacctgattctggtcacacagctggaacagctgcacaggcagggcctcctctca
ctgcagaagctctggttctacatccagccagccatgcgcaccatcgacatccttgcctcc
cttgccacctcagtggataaaggcgagtgtgtgggcgggtcgacactgagccttcttcat
gataggagcttcaactacaccggggacagccaggcgcaggagctgtgcctctatctgacc
aaggcagccagtgcaccttacttcgagatcctggagaagtggatctataggggcatcatt
catgacccatacagtgagttcatggtggaggaacacgagctgcggaaggagaagatccag
gaggactacaacgacaagtactgggaccagcgctacactgtgctgccgcagcagatccca
tccttcctgcagaaggtagcaggcaagatcctcagcacaggaaaatacctaaatgtggtc
agagagtgtggtcatgatgtcacctgtcccgtagccaaagaaatcatctatacccttaaa
gagcgggcatatgtggagcagatagagaaagcgttcaattatgccagcaaagtgctgctg
gacttcctcatggaggagaaggagctggtggcccacctgaggtccatcaagcgctacttc
ctgatggaccagggggacttcttcgtgcatttcatggacctgactgaggaggagctcagg
aagccagtggaggacatcatactcacacgcctggaggccctgttggagctggccctgcga
atgagcactgccaacactgaccccttcaaagacgacctcaagattgaactgatgcctcac
gacctaatcactcagcttttgcgggttctggccatcgagaccaagcaggaaaaggcaatg
acccatgctgaccccacggagctcacactgagtggtctggaggccttctcctttgactac
atggtcaaatggcccctgtcactgattattaacaggaaggcactcacccgctaccagatg
ctcttccgacacatgttctactgcaagcacgtggagcggcagctctgcagtgtctggatc
agcaacaagacggccaagcagcatgcactgcactccgccaagtggtttgctggtgctttc
actctgcggcagcgaatgctcaactttgtccagaatattcagtactacatgatgtttgaa
gtgatggaaccgacctggcacatccttgagaaaaacctgaaatctgcctccaacattgac
gatgtccttggccaccacacaagcttccttgacaactgcctgaaggactgcatgctgacc
aaccctgagctgctgaaggttttctccaagctcatgtccgtatgcgtcatgtttaccaac
tgtatgcagaaatttacacagagtatgaaactggacagtgagctaggccgtctgacactg
gatcagggtagtgtgcaggggccacccacagagactgaacggattgaggatcgcccccgg
aaggagcttaccaggaagcatctgtctgagcatgtggatgctcctcagctggcctctggt
ttcgaggccaccatcaacaactttgacaaaaacttctctgcccatcttcttgatttgctg
gcccgactaagtgtctacagcaccagtgactgcgaacatggcatggccagtgtcatctcc
agactagatttcaatggtttctatgctgaacgcctggaacgtctgtctgcagaaaggagt
cagaaggctgccccccaagtgcctgtcccacggggaccctcagcaccagcacccagggtg
gccattcctgcgcaatga

DBGET integrated database retrieval system