KEGG   Mus musculus (mouse): 74252
Entry
74252             CDS       T01002                                 

Symbol
Armc1, 2310016N05Rik, 2900046P06Rik, 3110009G21Rik, AA409258, AW048872, Arcp, C330014L16Rik
Name
(RefSeq) armadillo repeat containing 1
  KO
K17306  armadillo repeat-containing protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    74252 (Armc1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   74252 (Armc1)
SSDB
Motif
Pfam: Arm HMA
Other DBs
NCBI-GeneID: 74252
NCBI-ProteinID: NP_083116
MGI: 1921502
Ensembl: ENSMUSG00000027599
Vega: OTTMUSG00000051206
UniProt: Q9D7A8
Position
3:complement(19185566..19219225)
AA seq 282 aa
MNSSSSTMNEEPDALSVVNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSAL
LALRYLAECRANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNLADGDS
FNEMNSRRRKAQFFLGTTNKRAKTVVLHIDGLDDTSRRNLCEEALLKIKGVISFTFQMAV
QRCVVRIRSDLKAEALASAIASTKVMKAQQVVKSESGEEMLVPFQDAPVEVEENTELPDY
LPEDESPTKEQDKAVSRVGSHPEGGASWLSTAANFLSRSFYW
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaattcatcctcttctactatgaatgaagaacctgatgctctatcagtagttaaccag
ctacgggatttagcagcagatccactaaatagaagagccatcgtccaggatcagggatgt
ttgcctggccttattttatttatggaccatccaaaccctcctgtcgttcactcagctttg
cttgcgctacgctacttggctgaatgccgtgcgaatagagaaaagatgaagggagagctg
gggatgatgctgagcttgcagaatgtcatccagaagactacaactccaggagaaacaaaa
cttctggcctcagaaatctatgacatccttcaatcctccaatttggctgatggtgatagt
tttaatgaaatgaattcgcgtagaaggaaagctcagttttttttgggaactacaaacaaa
cgggccaaaacagtagttttgcacatagatggtctcgatgatacgtctcgacgaaatcta
tgtgaagaggccttgttaaaaattaaaggtgtcattagctttacttttcaaatggctgtt
caaagatgcgtggtgcggatccgttcagacttgaaggcagaggctctggcgtcagcaata
gcatcaaccaaggtcatgaaagctcagcaagttgtgaagagcgagagtggagaagagatg
ctggtcccttttcaggatgcccctgtggaagtggaagagaacacagagctacctgactac
ctgcctgaggatgagagtcccacaaaggagcaggacaaggcagtgtcccgggttggatcg
caccctgaaggtggagccagctggttgagcacagcagcaaactttttatccagatcattt
tactggtga

DBGET integrated database retrieval system