KEGG   Mus musculus (mouse): 74315
Entry
74315             CDS       T01002                                 

Gene name
Rnf145, 3732413I11Rik, TMRF1
Definition
(RefSeq) ring finger protein 145
  KO
K23789  RING finger protein 145 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    74315 (Rnf145)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     74315 (Rnf145)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    74315 (Rnf145)
SSDB
Motif
Pfam: TRC8_N zf-RING_2 zf-C3HC4_2 zf-rbx1 zf-RING_UBOX zf-C3HC4_3 zf-C3HC4 zf-RING_11 Prok-RING_4 zf-RING_5 zf-ANAPC11 Zn_ribbon_17
Other DBs
NCBI-GeneID: 74315
NCBI-ProteinID: NP_083138
MGI: 1921565
Ensembl: ENSMUSG00000019189
Vega: OTTMUSG00000005471
UniProt: Q5SWK7
Position
11; 11 B1.1
AA seq 663 aa
MAAKEKLEAVLNVALRVPSIMLLDVLYRWDVSSFFQQIQRSSLNNNPLFQYKYLALNMHY
VGYILSVVLLTLPRQHLVQLYLYFVTALLLYAGHQISRDYVRSELESAYEGPMYLEPLSM
NRFTTALIGQLVVCTLCSCVMKTKQIWLFSAHMLPLLARLCLVPLETIVIINKFAMIFTG
LEVLYFLGSNLLVPYNLAKSAYRELVQVVEVYGLLALGMSLWNQLVVPVLFMVFWLVLFA
LQIYSYFSTRDQPASRERLLFLFLTSIAECCSTPYSLLGLVFTVSFVALGVLTLCKFYLQ
GYRAFMNDPAMNRGMTEGVTLLILAVQTGLIELQVVHRAFLLSIILFIVVASILQSMLEI
ADPIVLALGASRDKSLWKHFRAVSLCLFLLVFPAYMAYMICQFFHMDFWLLIIISSSILT
SLQVLGTLFIYVLFMVEEFRKEPVENMDDVIYYVNGTYRLLEFVVALCVVAYGVSETIFG
EWTVMGSMIIFIHSYYNVWLRAQLGWKSFLLRRDAVNKIKSLPVATQEQLEKHNDICAIC
YQDMKSAVITPCSHFFHAGCLKKWLYVQDTCPLCHCHLKNSSQLPGLGTEAAPQPPAGAE
QNIVLQEGPEPPDHESPPGTGTQEGSGDSSEHINRGSASQEGAADAGEGPQIPEGEVCPV
ESA
NT seq 1992 nt   +upstreamnt  +downstreamnt
atggctgcgaaggagaaactggaggcagtgctgaacgtggccttgagggtgccaagcatc
atgctgctggatgtcctttaccgctgggacgtcagctcctttttccagcagatccaaaga
agcagcctcaacaacaaccctcttttccagtacaaatacttggctcttaatatgcattac
gtaggttatatcttaagtgtcgtgctcctcactctgcccaggcagcatctggtgcagctc
tatttgtattttgtgactgccctgctcctctatgctggacatcagatatccagggactac
gtaaggagtgaactggagtctgcctatgaaggaccaatgtatttagaacctctctccatg
aaccgctttaccacagccttaataggtcagttagtggtgtgcaccttgtgctcctgcgtt
atgaagacgaagcagatctggctcttctcggcacacatgcttcctctgctggctcgcctc
tgcctcgttcctctggagaccatcgtcatcatcaacaaatttgctatgatttttacagga
ttggaagtcctgtacttcctagggtctaatctcctagtaccgtataacctcgctaagtct
gcataccgggagttagttcaggtagtggaggtgtacggccttctggccttgggaatgtcc
ctgtggaaccagctggtggtgcccgtgctcttcatggtcttctggcttgttttatttgct
cttcagatctactcctacttcagcaccagagatcagcctgcatcccgggagaggcttctc
ttccttttcctgacaagcatcgccgagtgctgcagcacgccctactcccttctgggcttg
gtcttcaccgtgtcctttgttgccttgggtgttctgacactctgtaagttctacctgcag
ggataccgagccttcatgaacgatcctgccatgaatagggggatgacagaaggagtcact
ctgctgatcctggcggtgcagacggggctcatagaacttcaggtggttcaccgtgcattc
ctgctcagcatcatcctcttcatcgtcgttgcctctatcctgcagtccatgttggagatc
gcagatcccattgttttggcactgggagcatcgagagacaagagtttgtggaaacacttc
cgtgctgtgagcctctgcttgttcctcctcgtgttccctgcgtatatggcctacatgatt
tgccagttcttccacatggacttctggcttctcatcatcatctccagcagcatccttacc
tctctccaggttctgggaacactttttatttacgtcttatttatggttgaggaattccgc
aaagagcccgtggaaaacatggatgacgtcatctactacgtgaatggcacttatcgtctg
ctggagtttgttgtggccctctgtgtggtggcctacggcgtctcagagaccatctttgga
gagtggactgtgatgggctccatgatcatcttcatccattcctactacaacgtgtggctt
cgtgcccagctgggctggaagagtttccttctgcgcagggacgctgtgaataagattaag
tctctccctgtcgcgacgcaggagcagctggagaaacacaacgacatctgcgccatctgt
taccaggacatgaaatccgctgtgatcacaccttgcagtcatttcttccatgcaggatgt
cttaagaaatggctgtatgtccaggatacctgccctctgtgtcactgccatctcaaaaac
tcctcccagcttccaggactggggacagaagcggctccacagcctcctgcgggggccgag
cagaacattgtacttcaggaaggtcctgaacccccggaccatgagagtccaccagggact
gggacccaggaaggttctggggacagtagtgaacacatcaacagaggctcggctagccag
gagggggctgctgatgctggagagggtcctcagattccagaaggcgaagtgtgtcctgtt
gagtctgcctag

DBGET integrated database retrieval system