KEGG   Mus musculus (house mouse): 74319
Entry
74319             CDS       T01002                                 
Symbol
Mettl23, 1110005A03Rik, 1500035B17Rik, 4933424L15Rik
Name
(RefSeq) methyltransferase like 23
  KO
K23151  methyltransferase-like protein 23 [EC:2.1.1.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    74319 (Mettl23)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-
     74319 (Mettl23)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  Others
   74319 (Mettl23)
SSDB
Motif
Pfam: Methyltransf_16 Pox_F16
Other DBs
NCBI-GeneID: 74319
NCBI-ProteinID: NP_083141
MGI: 1921569
Ensembl: ENSMUSG00000090266
UniProt: A2AA28
Position
11:116734341..116740566
AA seq 253 aa
MDSVRPRAPWAPPPDPASLDSPTCEPGLMAGTQLFRFREEPVPGGNRAVLEVRVPQVLHV
QYGMYVWPCAVVLAQYLWFHRRSLPGKAVLEVGAGVSLPGILAAKCGAKVILSDSSEFPH
CLDICRQSCQMNNLPQVEVVGLTWGHISKDILSLPPQDIILGSDVFFEPEDFESILATVY
FLMQKNPKVQFWSTYQVRSADWSLEGLLYKWDMKCVHIPLESFDADKEDIAESTLPGRHT
VEMLIISFAKDSF
NT seq 762 nt   +upstreamnt  +downstreamnt
atggacagtgtccggccccgcgctccttgggcaccgcctcctgacccggcgtccctggac
tcccctacgtgcgagcccggcctcatggccgggacccagctctttcggttccgggaggag
ccagttcccggaggcaatcgggcggtgctggaggtccgcgtcccgcaggtcctgcatgtc
cagtatggaatgtatgtttggccctgtgctgtagtcctggcccaatacctgtggtttcac
agaagatctctaccaggcaaagctgtcttagaggttggcgctggagtgagccttcctggg
attttggctgccaaatgtggtgctaaagtaatactatctgacagctcagagtttcctcac
tgtctggatatctgcaggcaaagttgccagatgaataacctgccacaggtcgaagttgta
ggactgacatggggccacatatcaaaggacattctgtctttgccaccacaagacatcatt
cttggatctgatgtgttctttgaaccagaagactttgaaagcattttagccacagtatac
ttcctgatgcagaagaatccaaaagttcaattttggtctacataccaggtccgaagtgct
gactggtcacttgaaggcttgctctacaagtgggatatgaaatgtgtgcatattcctctg
gagtcttttgatgccgacaaggaagacatagcagagtctacccttccaggaagacatact
gttgaaatgctgatcatctcctttgcaaaggacagtttctga

DBGET integrated database retrieval system