KEGG   Mus musculus (mouse): 74330
Entry
74330             CDS       T01002                                 

Gene name
Dnajc14, 5730551F12Rik, DNAJ, DRI, DRIP78, HDJ3, L, LIP6
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C14
  KO
K09534  DnaJ homolog subfamily C member 14
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    74330 (Dnajc14)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   74330 (Dnajc14)
SSDB
Motif
Pfam: Jiv90 DnaJ
Other DBs
NCBI-GeneID: 74330
NCBI-ProteinID: NP_083149
MGI: 1921580
Ensembl: ENSMUSG00000025354
UniProt: Q921R4
Position
10; 10 D3
AA seq 703 aa
MAQKHPGERRLCGAHRSGGTSLSTSGSSVDPEILSFSGLRDSAETAPNGTRCLKEHSGPK
YTQPPNPAHWSDPSHGPPRGPGPPRGGGYPDESETGSEESGVDQELSRENETGYQEDGSP
SFLSIPSACNCQGSPGVPEGTYSEEGDGSSSSLCHHCTSPALGEDEELEEEYDDEEPLKF
PSDFSRVSSGKKPLSRRQKHRFLIKEDVRDSGRREPKAPGRHRLARKRSQTDKRRGLGLW
GVEELCQLGQAGFWWLIELLVLVGEYVETCGHLIYACRKLKGSDLDLFRVWVGVWARRLG
GWARMMFQFLSQSFFCVVGLLIRILRVVGAFLLLALALFLGCLQLGWRFSVGLGNRLGWR
DKTAWLFSWLGSPALHHCLTLLKDSRPWQQLVRLIQWGWQELPWVKQRTKKQGNAPVASG
RYCQPEEEVTRLLTMAGVPEDELNPFHVLGVEATASDTELKKAYRQLAVMVHPDKNHHPR
AEEAFKILRAAWDIVSNPERRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSR
CQGKHRRFEMDREPKSARYCAECNRLHPAEEGDFWAESSMLGLKITYFALMDGKVYDITE
WAGCQRVGISPDTHRVPYHISFGSRVPGTSGRQRATPESPPADLQDFLSRIFQVPPGPMS
NGNFFAAPHPGPGTTSTSRPNSSVPKGEAKPKRRKKVRRPFQR
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggcccagaagcacccgggagaaagaaggttgtgtggagcccaccgcagtggtggtacc
tccctcagtacatcaggatcctctgtggaccccgaaatactttcattctcaggactcagg
gactcagcagagactgctcctaatggtacacgatgcctcaaagagcactccggccctaag
tacacacagcctccaaatccagcccactggtcagatccaagccatggtcctccaaggggt
ccaggaccacctagaggaggaggctaccctgatgagagcgagacaggttcagaagagtca
ggagtggaccaggaactctcaagagagaatgagactgggtaccaggaggatgggagtcct
tcttttctttccattccatctgcttgtaactgccagggaagccctggagtccccgaagga
acttactccgaggaaggagatggctcttctagcagcctttgccaccattgcacctctcca
gccttgggggaagatgaagagttggaagaagaatatgatgatgaggaacctcttaaattt
cccagtgatttttcacgtgtgtccagtggaaagaaacccttgtcccggaggcagaagcac
cgttttctgatcaaggaggatgttcgggatagtggacgcagagaacccaaggccccaggt
cgtcatcggctggcccgaaaaagaagtcagacagataagcgcagaggcctgggactgtgg
ggagtagaggaactatgtcagcttggacaagcaggcttctggtggctgattgaacttctg
gtattggtgggagagtatgtggaaacctgtggccatctcatttacgcatgcaggaagctg
aaaggcagtgacctggacctttttcgagtctgggtgggggtctgggccaggagactgggg
ggctgggcccgcatgatgttccagtttctaagccagagcttcttctgtgtggtggggctg
ctcatccgtattcttagggtagtgggtgctttcctactcctggctctcgccctctttttg
ggatgtctacaattgggctggaggttttcggtgggactgggcaaccggttaggctggagg
gataagaccgcttggctgttctcttggctgggttctccagccttgcatcattgcttgact
ctgctgaaagatagcaggccatggcagcagctggtaaggttaatacagtggggctggcag
gagctgccctgggtcaaacagaggactaagaaacagggcaatgcacctgtagctagcggg
cgatactgccagcctgaagaggaagtgacccgactcttgaccatggctggggttcctgaa
gatgaactaaacccttttcatgtgctgggggttgaagctacagcatccgacactgaacta
aagaaggcctataggcagctagcagtaatggtccatcctgataaaaatcaccatccccgg
gctgaggaggccttcaaaattttgcgggcagcttgggacattgtcagcaacccagagagg
cggaaggaatatgagatgaaacggatggcagagaatgagctcagccggtcagtgaatgag
tttctgtcgaaactacaagatgacctcaaggaggcaatgaacacgatgatgtgcagcaga
tgccaaggaaagcataggaggtttgaaatggaccgggaacccaagagtgccagatactgt
gctgagtgtaacaggctgcatcctgctgaggaaggagacttttgggcagagtcgagcatg
ctgggcctcaagatcacttactttgcgctgatggatggaaaggtgtatgacatcacagag
tgggctggatgccagcgtgtgggtatctccccagatactcacagagttccttaccacatc
tcatttggttctcgggtacccggcaccagtggccggcagagggccactccagagtcccct
cctgctgacctgcaggatttcttgagccggatctttcaagtacctccggggccgatgtcc
aatgggaacttctttgccgcacctcaccctggccctgggaccacttcgacctctaggccc
aacagttcagtacccaagggagaagccaaacctaaacggcggaagaaagtgaggcggccc
tttcaacgatga

DBGET integrated database retrieval system