KEGG   Mus musculus (house mouse): 74335
Entry
74335             CDS       T01002                                 
Symbol
Xrcc3
Name
(RefSeq) X-ray repair complementing defective repair in Chinese hamster cells 3
  KO
K10880  DNA-repair protein XRCC3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    74335 (Xrcc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    74335 (Xrcc3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     74335 (Xrcc3)
SSDB
Motif
Pfam: Rad51 AAA_25 ATPase RecA DnaB_C
Other DBs
NCBI-GeneID: 74335
NCBI-ProteinID: NP_083151
MGI: 1921585
Ensembl: ENSMUSG00000021287
UniProt: Q9CXE6 Q80W51
Position
12:complement(111769626..111780326)
AA seq 349 aa
MDLDQLDLNPRITAAVKRGRLKSVKEILCYSGPDLQRLTGLPSHDVQCLLRAASLHLRGS
RVLSALHLFQQKESFPEQHQRLSLGCPVLDQFLGGGLPLEGITGLAGCSSAGKTQLALQL
CLAVQFPRQYGGLEAGAVYICTEDAFPSKRLWQLIAQQRRLRTDAPEELIEKIRFSNHIF
IEHAADVDTLLECVSKKVPILLSRGMARLVVVDSIAAPFRCEFHLQASAIRAKLLLSLGA
TLRRLSSTFRSPVLCINQVTDMVEDQQSVSRSLGASEERLSPALGITWANQLLMRLMVDR
THEDDVTTGLPRSPVRTLRVLFAPHLPLSSCCYTVSGEGIRGMPGTQSY
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggacttggatcagctggacctaaacccccgaattactgctgcggttaagaggggcaga
ctgaagtcagtgaaggagattctgtgctactccggaccagacttgcagcggctcaccggc
ctgcccagccacgatgtgcagtgcctgctgagagctgcctctctacaccttcggggaagc
cgcgtcctctcagcactgcatctgttccagcagaaggagagcttccctgagcagcatcaa
cgcctgagcctaggctgccctgtcctggatcagttcctgggtggaggcctgcccctggag
ggcatcactggcctggctggctgcagctcagcaggaaagacccagctggcgctacagctc
tgcctggctgtgcagttcccaagacaatatggaggcctagaggccggggctgtctacatc
tgcacagaagatgccttccccagcaagcggctgtggcagctcatcgcgcagcagcggagg
ctgcggacagacgcgcctgaggagctgatcgagaagatcaggttcagcaaccacatcttc
attgaacacgcggccgacgtggacaccttgttggagtgtgtgagtaagaaagtccccatc
ctgctgtcgaggggcatggcccgcctggtggtggttgactccattgcagccccatttcgt
tgtgagttccaccttcaggcctcagccatcagggcgaagctcctgctctcgctgggggcc
acactgcgaagactgagcagcaccttcaggagcccagtgctgtgcatcaaccaggtgaca
gacatggtggaggaccagcagtctgtgtccaggtcactaggggcttcagaagagcgcctc
tctccagcccttggcatcacctgggctaaccagctcctgatgcgactgatggttgaccgc
acccatgaggacgatgttaccacaggcttgcccagaagcccagttcggactctccgagtg
ctcttcgccccccacctacccctctcctcctgctgctacacagtcagtggggaaggcatt
agggggatgccaggaacacagtcctactaa

DBGET integrated database retrieval system