KEGG   Mus musculus (mouse): 74337
Entry
74337             CDS       T01002                                 

Gene name
Palm3, 4432412L15Rik, AL024300
Definition
(RefSeq) paralemmin 3
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: Vps23_core
Other DBs
NCBI-GeneID: 74337
NCBI-ProteinID: NP_083153
MGI: 1921587
Ensembl: ENSMUSG00000047986
Vega: OTTMUSG00000032834
UniProt: A2TJV2
Position
8; 8 C2
AA seq 734 aa
MALQTPVLSPATPTVMAESALYRQRLEVIAEKRRLQEEIGAARRELEEEKLRVERLKRKS
LRERWLMDGAAEGPERPEEPASKDPQSPEGQAQARIRNLEDSLFSLQSQLQLLQSASTGA
QHRPAGRPAWRREGPRPLSQSAMEAAPTAPTDVDKRTSLPDAPVGMSPESPSDPREESIA
VLPASRPSTEAIGTSSEANGPCPGHSPLPEQLSLGVSSVTKAKGDGAVEVVWAGLRATEN
SATGPTDVELEAKVEEVVLEAIGARQGTSSPELPTWVKEGRGVVEVVWEGLGGRDLDVTG
ESGRDAEATHTSSRRLQEQFEAETCRKEEGASRDSLEGVGQGGPGVEEGSFIWVERVALS
EDWEEILMEGLEAPQGAGSAGEPEALIGAQPRGGEASWEVEKREVEKVEGIEEKGRAEKL
GAEREDGVAVLPDETQGREENEAEKVERKDSEGPFPAEIATDEEKWEVKTTEGEESLEVE
KGGEAEPVTTEKPLVTEKKPEGSLETERKGSEMPLDQEKDGEGSLDRESKTTEILLDGEI
GDKSSLDETKGSKKLLDEKTGGEGSLDEEAEGSKKLLDREADGIEPFSEVDKTSGAKDDV
SPEEQGKANEGAEFQAEDASPPGATVCVQDEPRSEEQGQQEPEKQEGLVEGAASKPEPCT
EREGPPGDATLLLAETPAPEQPVESQPLLHQEASSTNPGDHPAPTYAPAQQLELAEAKEA
SGPKQKTCQCCVVM
NT seq 2205 nt   +upstreamnt  +downstreamnt
atggctctgcagaccccggtgttgtctccggccacacccacggtcatggcggagagcgcc
ctctatcggcagcggctggaggtcatcgctgagaagcggcggctgcaggaggagatcggc
gccgcgcgtcgcgagctggaggaggagaaactccgcgtggagcggctcaagaggaaatct
ctccgagaacgttggctcatggacggggcagctgaagggccagaacggccggaggaaccc
gcctccaaggacccacagtcgcctgagggacaggcccaggctcgaattcgcaacctggaa
gacagtttgttttcactccagtcacagctacagctgttgcaaagtgcgtccacaggtgct
caacacagacctgctggtaggcccgcctggcgcagagagggtccccgtcctctctctcag
tctgccatggaagcagctcctaccgccccgactgatgtggacaagcgaacttccctgcca
gatgctccagtgggcatgtcccctgagtctccttctgatcccagggaggagtcgattgcg
gttctaccagcctcgaggccatccactgaagctatagggacatcttcagaagccaatggc
ccctgccctgggcacagccctctcccagagcagctgagtctaggggtgtcgagtgtcact
aaggccaaaggagatggtgcagtggaggtggtttgggctgggcttagagccactgagaac
agtgccacaggccccacagatgtggagctggaggctaaggtggaagaagtggttctggag
gccattggggccaggcagggcaccagcagccctgagctccccacttgggtgaaggagggc
aggggtgtagtggaagtggtctgggaggggctgggaggcagggatcttgatgtcacaggg
gagtcaggcagggatgcagaggccacacacaccagttccaggagactccaggagcaattt
gaggctgaaacttgcagaaaagaagaaggtgcttccagagatagtcttgagggtgttggg
cagggaggtcctggagtagaggagggatccttcatttgggtggagagagtggccctcagc
gaagactgggaggagattttgatggagggtttggaagcaccgcagggggcagggtctgca
ggagaacctgaggctttgattggagcacagcccagaggaggtgaagcgtcctgggaggta
gagaagagagaagtagagaaagttgagggcatagaagagaagggaagggcagaaaagctc
ggggcagagagggaggatggtgtagctgtgctgccagatgagacccagggaagagaggaa
aacgaggcagaaaaggtagagagaaaagacagtgagggcccctttccagcagagatagca
acagatgaggaaaagtgggaggtgaaaacgacggaaggtgaagagtcgttggaagtagaa
aagggaggtgaggcagagccggtcaccactgagaagccattggtgacagaaaaaaagcca
gagggctcactggagacagagagaaaaggaagtgagatgccattggaccaggagaaagat
ggtgagggctcattggacagagaatcaaaaacaactgagatactattggatggagagata
ggagataagagctcattggatgaaactaaaggaagcaagaaactattagatgagaagaca
ggaggtgagggctcattggatgaagaagctgaaggaagtaagaaactattggacagggag
gcagatggcatcgagccattctctgaggtggacaagacctcaggcgccaaggatgatgtg
agtccagaagagcaaggcaaagccaacgaaggagcagagttccaggcggaggatgccagc
ccaccaggagccactgtttgtgtccaggacgagcccaggtcagaggagcaaggacagcaa
gaaccagagaagcaagaaggcctggtagaaggggcagccagtaagcctgagccctgtact
gagcgagagggtcccccaggggatgctaccctgctcctagctgagaccccagccccggag
cagcctgtggaaagccagccactgctccatcaggaagcgtccagcactaaccctggtgac
caccctgcacctacgtatgcccctgcccagcagcttgagctggctgaggccaaagaagct
agtggtcccaagcagaagacgtgccagtgttgtgtggtcatgtga

DBGET integrated database retrieval system