KEGG   Mus musculus (house mouse): 74340
Entry
74340             CDS       T01002                                 
Symbol
Ahcyl2, 4631427C17Rik, AI227036, Adohcyase3, mKIAA0828
Name
(RefSeq) S-adenosylhomocysteine hydrolase-like 2
  KO
K01251  adenosylhomocysteinase [EC:3.3.1.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00270  Cysteine and methionine metabolism
mmu01100  Metabolic pathways
Module
mmu_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    74340 (Ahcyl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    74340 (Ahcyl2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    74340 (Ahcyl2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.1  Thioether and trialkylsulfonium hydrolases (deleted sub-subclass)
    3.3.1.1  adenosylhomocysteinase
     74340 (Ahcyl2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     74340 (Ahcyl2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   74340 (Ahcyl2)
SSDB
Motif
Pfam: AdoHcyase AdoHcyase_NAD 2-Hacid_dh_C THF_DHG_CYH_C Shikimate_DH IlvN NAD_binding_7 AlaDh_PNT_C TrkA_N SR-25 DEC-1_N
Other DBs
NCBI-GeneID: 74340
NCBI-ProteinID: NP_067389
MGI: 1921590
Ensembl: ENSMUSG00000029772
UniProt: Q68FL4
Position
6:29768378..29912309
AA seq 613 aa
MSVQVVSAAAAAKVPEVELKDLSPSEAEPQLGLSAAAVGAMVPPAGGGDPEAPAPAPAAE
RPPAPGPGSGPTAALSPAAGKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRT
VKKQIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTDSSDDETSPRDKQQK
NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQ
TAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVN
VEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMN
VNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIV
YVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNM
GHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSI
TATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGL
NKNGPFKPNYYRY
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgtcggtgcaggttgtgtcagcagcggcagccgccaaggtgcctgaggtggagctgaag
gatctgagcccctccgaggcggagccccagttgggactgagcgcggcggccgtgggcgcc
atggtacccccagcgggtggcggggacccagaggctccagctccggctcccgcggcggag
cggcccccggcccccggcccgggctcggggcccaccgcggctctgagccctgcggccggg
aaggtccctcaagcgtccgccatgaagcggagcgaccctcatcaccagcaccagcggcat
cgcgacggcggcgaggccttggtcagccccgacggcacggtcaccgaggcgccgcgcacg
gtcaagaagcagattcagtttgctgaccagaagcaggaattcaacaaacgtcccaccaaa
atcggacgtcgctctttgtctcgttccatctctcagtcatctactgacagctatagctca
gctgcctcatatacagatagctctgacgatgagacatcccccagggacaagcagcaaaag
aactctaagggaagtagcgacttctgtgtcaagaacatcaaacaagcggagtttggacgc
agagaaattgaaattgctgagcaagagatgcctgccttgatggctttaaggaagagagcc
caaggagaaaagcctttggctggagccaaaattgtgggttgtacgcacatcactgctcag
acagccgtgcttatggagacactgggtgctctgggggcacagtgccgatgggctgcctgc
aacatctactccaccctcaatgaagtggctgctgctctcgcagaaagtgggtttcccgtc
tttgcctggaaaggagaatcagaagatgacttttggtggtgcattgacagatgcgtgaat
gtggagggctggcagccaaacatgatactggatgatggaggagatctgactcactggatt
tataaaaagtatcccaacatgtttaaaaaaatcaaaggcatagtcgaggagagtgttact
ggagtccataggctgtaccaactgtccaaagctgggaagctgtgtgttcccgccatgaac
gtcaatgactcagtcactaagcagaaatttgataacctctactgttgccgtgaatctatt
cttgacggacttaaaaggacaacagatatgatgtttggtggaaagcaggtggtggtctgt
ggctatggagaggtgggaaaggggtgctgcgctgctctgaaagccatgggctccattgtg
tacgtgactgagattgaccccatctgtgccctgcaagcctgtatggatggattccgacta
gtgaagctgaatgaagtcatccgacaggtcgacattgttattacttgcacagggaacaag
aatgtggtaaccagagagcacttggaccgtatgaagaatagctgcatcgtttgtaacatg
ggccattccaacaccgagattgatgtggccagcctgcggacaccagaactgacctgggag
agagtaagatcccaagttgatcatgtgatatggcctgatggcaagaggatagtactgctg
gcagagggccgtctactgaatctcagctgctccacagtgcctacatttgtgctctccatc
actgctaccactcaggctctcgccttgatagaactttacaatgctcctgagggtcgctat
aagcaagatgtgtacctgctacccaagaaaatggatgagtatgtggcaagcctacacctg
cccacctttgatgcccacctgacagagctaacagatgaacaagccaagtatctgggactc
aacaagaatggacccttcaagcctaactactacaggtattaa

DBGET integrated database retrieval system