KEGG   Mus musculus (mouse): 74343
Entry
74343             CDS       T01002                                 

Gene name
Crtc2, 4632407F12Rik, Torc2
Definition
(RefSeq) CREB regulated transcription coactivator 2
  KO
K16333  CREB-regulated transcription coactivator 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    74343 (Crtc2)
   04152 AMPK signaling pathway
    74343 (Crtc2)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    74343 (Crtc2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    74343 (Crtc2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    74343 (Crtc2)
SSDB
Motif
Pfam: TORC_M TORC_C TORC_N
Other DBs
NCBI-GeneID: 74343
NCBI-ProteinID: NP_083157
MGI: 1921593
Ensembl: ENSMUSG00000027936
Vega: OTTMUSG00000021260
UniProt: Q3U182
Structure
PDB: 
5ZKO 5ZK1

Position
3; 3 F1
AA seq 692 aa
MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLA
YTRSSHYGGSLPNVNQIGCGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDARRMVSPLRR
YPRHIDSSPYSPAYLSPPPESGWRRMMPWGNLPAEKGQLFRLPSALNRTSSDSALHTSVM
NPNPQDTYPGPTPPSVLPSRRGGGFLDGEMDAKVPAIEENVVDDKHLLKPWDAKKLSSSS
SRPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGSLPDLTNLHFPPPLPTPLDPEETVYP
SLSGGNSTTNLTHTMTHLGISGGLGLGPSYDVPGLHSPLSHPSLQSSLSNPNLQASLSSP
QPQLQGSHSHPSLPASSLAHHALPTTSLGHPSLSAPALSSSSSSSSTSSPVLSAPPYPAS
TPGASPRHRRVPLSPLSLPAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLPT
DQRLPPYPYSPPSLVIPTHPPTPKSLQQLPSQACLVQPSGGQPPGRQPHYGALYPPGSSG
HGQQPYHRPINDFSLGNLEQFNMESPSTSLVLDPPAFSEGPGFLGSEGSMSGPQDPHVLN
HQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSASGLELGLGLEDELRME
PLGLEGLTMLSDPCALLPDPAVEDSFRSDRLQ
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggcgacgtcaggggcgaacgggccgggttccgccacagcctcagcgtccaatccacgc
aagtttagtgagaagattgcgctgcagaagcagcgtcaggccgaggagacggcggccttc
gaggaggtgatgatggacatcggctccacacggttacaggcccaaaaactgcgactggct
tatacaaggagctcccattatggtggttctctgcccaatgttaaccagattggctgtggc
ctggctgagttccagagcccccttcactcacctttggattcatctcggagcactcggcac
catgggttggtggaacgggtacaacgagatgcccgcagaatggtgtccccactccgccga
tacccccgccacattgacagttctccatatagccctgcctatttatctcctcccccagag
tctggctggcgaaggatgatgccctggggcaacctcccagctgagaaggggcagttgttt
agactgccgtctgcacttaacaggacaagctctgactctgctcttcacacaagtgtgatg
aaccctaacccccaagacacttatccaggccccacacctcccagtgtcctgcccagccgc
cgaggaggaggttttctggatggtgagatggatgctaaagtccctgctattgaggagaac
gtggtagatgacaagcatctgctgaaaccttgggatgctaagaagctgtcctcatcttcc
tctcgacctcgatcctgtgaagtccctggaatcaacatctttccatctcctgaccagcct
gctaatgtgcctgtcctcccacctgccatgaacacaggaggctccctacctgacctcacc
aacctacacttccctcctccactgcccacacccctggaccctgaggagacagtctatccc
agcctgagtgggggcaacagtaccaccaatttgacccatactatgacccatttgggcatc
agtggaggtctgggcttgggccccagctatgatgtaccaggacttcactcacctcttagc
cacccatccctgcagtcctccctaagcaatcccaacctccaggcttccctaagtagtcct
caaccccagctccagggctcccatagtcacccatcactgcctgcctcctccttggcccac
catgcactgcccaccacctccctgggccacccgtcacttagtgccccagccctttcctcc
tcctcttcctcttcgtccacttcatctcctgtcctgagtgctcccccttacccagcttct
actcctggggcctctccccgccaccgtcgtgtgcccctcagccccctgagcttgcccgcg
ggcccagccgacgccagaaggtcccaacagcagctgcccaaacagttttcgccaacaatg
tcacccaccttgtcttccatcactcagggcgttcccttggataccagtaaattgcctact
gaccagcgattgcccccatacccatatagccccccaagtctagttatacccacccatcca
cccaccccaaagtctctacagcagttgccctctcaggcctgcttagtgcagccctcaggt
ggacagcctccaggcaggcagccacattatggggcactgtacccacctgggtccagtgga
catgggcaacagccttaccaccgcccaataaatgacttcagcttggggaatctggagcaa
ttcaacatggagagcccatcaaccagcctggtgctggatccccctgccttttctgaaggt
cctggatttttagggagtgagggatcaatgagtggcccccaggaccctcacgtcctcaac
caccagaacttgacccactgttcccgccatggctcaggacctaatatcatactcacagga
gactcttccccaggtttctctaaggagattgcagcagccctggctggagtgcctggcttt
gaggtgtcagcatctgggttggagctgggcctggggctagaagatgagctgcgcatggag
ccactgggcctggaaggactaactatgctgagtgacccctgtgccctgctgcctgaccct
gctgtggaggactcattccgtagtgatcggctacagtga

DBGET integrated database retrieval system