KEGG   Mus musculus (mouse): 74347
Entry
74347             CDS       T01002                                 

Symbol
Meak7, 4632415K11Rik, Kiaa1609, Tldc, Tldc1
Name
(RefSeq) MTOR associated protein, eak-7 homolog
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: TLD FERM_N
Other DBs
NCBI-GeneID: 74347
NCBI-ProteinID: NP_083159
MGI: 1921597
Ensembl: ENSMUSG00000034105
Vega: OTTMUSG00000061655
UniProt: Q8K0P3
Position
8; 8 E1
AA seq 455 aa
MGNAKSLSGQKMASRFLPEEQAEVDKLFDVLSSSEGGVATGTFSLEAMKSHVKEALPPAM
VTRLYNGMQRVKPTDRTLGSCRSVSREQFTAFLSQLLRGSCEEKGLMVMNMISDAEGPTK
TRDVQKFTEDLVASVAHVLTHRHELRGWTCRKSEVPPDSMQAMVAQLLSEMKFQDGYKFQ
GPQCLDQVCDQAMIEEWVFHVPHVGMFLSVVVHRGLCLLGSSFDPSTLVPECLADQGGRF
ESILDVLSVIYLSSHLAPEHRQRWRLLFSTQLHGQSFSQLCSHITSQGPSLLVLEDRDGY
VFGGFASCSWEVKPQFQGDNRCFLFSIAPRMATHLHTGYNNHFMYLNYGQQTMPNGLGMG
GQHHYFGLWVAADFGKGHSKAKPACTTYNSPQLSAQEDFLFDKMEVWGLGNLLEEYEGKN
KKSVLDSNPEARSLLEISGRARHSEGLREVPRDED
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggggaatgccaagagcctgtcgggccagaagatggcctcaaggttcttgcccgaggag
caggctgaggtagacaagctgtttgatgtcctgtcatctagtgaaggcggtgtggcaacg
gggacattctctctggaggcgatgaagagccatgtcaaggaggccctccccccagcgatg
gtcaccagactgtataacggcatgcagagggtgaagccaaccgacaggacactcgggagc
tgcaggagtgtttccagagagcaattcactgcattcctgtcccagctgttgagagggagc
tgtgaggaaaaaggcctaatggttatgaacatgatctcagatgcagagggtcctacaaag
accagagatgtccagaagttcacagaggacctggtggcctctgtggcgcacgtgctgacc
caccggcatgagcttcgaggctggacctgcaggaaatccgaggtgccccctgacagtatg
caggccatggtcgcccagctgctctctgagatgaagtttcaagatggctacaagttccag
ggccctcagtgcctggaccaggtctgcgaccaagccatgatcgaggagtgggtgttccac
gtccctcacgtgggcatgttcctgagcgtggtcgtccacaggggcctgtgcctcctgggt
tcatcctttgatccgtccacgctggtccccgagtgcctcgcggaccaaggtggccggttc
gagagcatcctggatgtgctgtccgtcatctacctcagctcccacctggccccggagcat
cggcaacgctggcgcctgctgttctccacgcagctccacgggcagagcttctcccagctc
tgcagccacatcaccagccaggggcccagcctgcttgtccttgaggacagggatggctac
gtctttggtggcttcgcctcctgctcttgggaagttaagcctcagttccaaggggacaac
agatgtttcctgttctccattgcccccagaatggccacgcacctgcacacgggctacaat
aaccacttcatgtacttgaattacggacagcaaaccatgcctaatggactgggcatgggt
gggcagcaccattactttgggctttgggtggctgccgactttgggaaaggacacagcaag
gcgaagccagcgtgcaccacctacaacagcccacagctctctgcccaggaggacttcctg
ttcgataagatggaggtgtggggacttggcaacctcttagaggaatatgagggcaagaac
aagaagagcgtcctggactcaaatcccgaagcccgtagcctgttggagatcagcggacgg
gctcggcacagcgagggactgcgggaagtccccagggatgaggactga

DBGET integrated database retrieval system