KEGG   Mus musculus (house mouse): 74354
Entry
74354             CDS       T01002                                 
Symbol
Lrguk, 4921528H16Rik
Name
(RefSeq) leucine-rich repeats and guanylate kinase domain containing
  KO
K25549  leucine-rich repeat and guanylate kinase domain-containing protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    74354 (Lrguk)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   74354 (Lrguk)
SSDB
Motif
Pfam: Guanylate_kin LRR_4 LRR_8 LRR_9
Other DBs
NCBI-GeneID: 74354
NCBI-ProteinID: NP_083162
MGI: 1921604
Ensembl: ENSMUSG00000056215
UniProt: Q9D5S7
Position
6:34006183..34110969
AA seq 820 aa
MAAFERNPSRWKGTRFRRGLGASRIAAQAILSLTEKQSQGRWPSFPLGLKSKGTFRSASS
YLLHQLIHRSHEAEAEQEEKQQEDGESEESEESEMQNLEDKYDGILREETVAEAITGLGW
SGRGTEQVYLNLNLSHCELVDISILCGYVHLQKLNLSGNRIEDLSCVSCMPYLLELNASQ
NKLTTFFNFKPPQNLKKVDFSSNLISEMYDLSAYHTLTQLILDNNEIEEITGLENCISLT
HLSLAGNKITTIKGLGTLPIKVLSLSNNMIETITGLEELKALQNLDLSHNQISSLQGLEN
HDLLEVINLEDNKIKELSEIEYIENLPILRVLNLLRNPIQTKPEYWFFVIYMLLRLTELD
QQKIKVEEKVFAVNKYDPPPEVVAVQDHMTHVVNSMSQPQRIWDSTLPSLDAPYPMLILT
GPAACGKRELAHRLCRQFSTYFRYGACHTTRPPYFGEGDRVDYHFISQEVFDEMLNMGKF
ILTFNYGNHNYGLNRDTIEGIARDGLASCIHMELEGVRSLKYSYFEPRYILVVPMDKEKY
EGYLRRKGLFSRAEIEIAVSRVDLYVKVNQKYPGYFDAVINADDMDIAYQKLSELIREYL
GLTETAAKTLAPTADTKTSYLKCEDYSRKSSTVEFLDSTDRNYFTKLWAKLSSKKSPVER
ESLHRQHEAARQALMGKTPRDHTLLFQRGPVPIPTVSGQQYFATIDELQKTFELSDDLFK
TPSGTYPETSKDSNISKRYSTYFHTCPWSKELPFQLPEGGISSRPGSAGSDEVDGALKAL
RVASSMQEKVAQHKRLSAITIMDPGSNTKPTLPPIPHGRR
NT seq 2463 nt   +upstreamnt  +downstreamnt
atggcggccttcgagcgaaatccctcgagatggaaaggcacccgtttcaggcggggtttg
ggcgcctctcgcattgcagcccaggcgatactgtcgctcacagaaaaacaaagtcagggc
cgttggccttctttccccctgggtctgaagtcaaaagggactttcagaagcgcctcctct
tacctcctccaccagctcatccaccgctctcatgaggcagaagcggagcaagaagagaag
caacaggaggacggagaatctgaagagtcagaggagtccgaaatgcagaatttggaggac
aagtatgacgggatcctgagagaggagaccgtggctgaggcaatcactggattggggtgg
tcaggccgtggcacggagcaggtttacctcaacctgaatctatcgcactgtgagttggtc
gacatcagcattctgtgtggctatgtccacctgcagaagttgaatctttcgggaaacaga
atcgaagatttgtcttgtgtgagctgcatgccgtatcttctagaactaaatgcttctcag
aacaagctgactaccttcttcaatttcaaaccaccccaaaatctcaagaaggtggatttt
tcctccaacctgatttccgagatgtatgacctgtcagcgtaccatactctcactcaacta
attttggacaacaacgagatagaagaaatcactgggctagagaactgcatcagcctgacc
caccttagtctggctggcaacaagatcactaccatcaaaggcttagggacattacccatc
aaagtgctttctttgagtaacaacatgattgagaccatcacaggtctggaggagctgaaa
gccttgcagaacctggacctgtcccacaatcagatcagcagcctccagggcttggagaac
catgacctcctggaagtgattaacctggaggataacaagattaaggagctgagtgaaata
gaatacattgaaaatcttcctatccttcgagttctcaatctactaaggaatccaattcag
accaagcccgagtactggttcttcgtgatatatatgctgctgcgactgacagagttagac
cagcagaagattaaggtagaagaaaaggtttttgcagtgaataagtatgaccctccccct
gaggtggtcgctgtccaagatcacatgacccatgttgtcaacagcatgtcgcagccacag
aggatctgggacagcaccctgccgagtctggatgccccgtatcccatgctcatactaact
gggcctgcagcttgcgggaaacgagaactcgcccaccgcctctgcagacagtttagtact
tacttcagatatggggcctgtcacaccacgagaccgccttactttggtgaaggagatcga
gttgattatcatttcatttcccaagaagtttttgacgaaatgctgaacatggggaaattt
attttaacatttaattatggcaatcacaattatggattaaatagggacacgatagaaggt
attgcaagagatggattagcaagctgcattcatatggaattagaaggtgtaagaagtttg
aaatattcttattttgagcctcgatatatcttggtggtgcctatggacaaggaaaaatat
gagggatacttgcggagaaagggattgttcagtcgcgcagaaatcgaaattgccgtctcc
agggtggacctttatgttaaagttaatcagaaatacccaggatattttgatgcagtaatc
aatgcagatgacatggacattgcctaccaaaagctcagcgagctcattagagaatacctg
gggttgactgagacagctgctaagaccttggctccaactgcagatactaagacgtcttac
ctgaaatgcgaagactattctaggaagtccagtacagttgaattcttggattcaacagac
agaaactactttaccaaattatgggccaaactttcatccaaaaagtcaccagtggaaaga
gagtctctccacagacagcatgaggcagcccggcaggcgctcatggggaagacgccccgt
gatcacacgctcctgtttcaaaggggtccagtaccgatacctactgtcagtggccaacag
tattttgcaacaatagatgaactacagaaaacgtttgagctctctgacgatctctttaaa
accccctctggaacataccctgaaacaagcaaggattccaatatttctaagagatattct
acatactttcatacttgtccatggtccaaagaacttccctttcagcttccagagggtggg
atctcatcgcgcccagggtcagcagggagtgacgaagtcgatggggcattgaaagctctt
cgtgtagcatcatctatgcaggaaaaagtggcccagcacaaaagactgtctgcgattaca
ataatggacccgggttccaacaccaaacccacccttcctccgatcccgcacggccgcaga
tag

DBGET integrated database retrieval system