KEGG   Mus musculus (mouse): 74355Help
Entry
74355             CDS       T01002                                 

Gene name
Smchd1, 4931400A14Rik, AW554188, MommeD1, mKIAA0650
Definition
(RefSeq) SMC hinge domain containing 1
  KO
K23113  structural maintenance of chromosomes flexible hinge domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    74355 (Smchd1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    74355 (Smchd1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    74355 (Smchd1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Other NHEJ factors
     74355 (Smchd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HATPase_c_3 SMC_hinge HATPase_c
Motif
Other DBs
NCBI-GeneID: 74355
NCBI-ProteinID: NP_083163
MGI: 1921605
Ensembl: ENSMUSG00000024054
Vega: OTTMUSG00000033170
UniProt: Q6P5D8
Position
17; 17 E1.3
AA seq 2007 aa AA seqDB search
MAAEGASDPAGLSEGSGRDGAVDGCRTVYLFDRRGKDSELGDRALQVSEHADYAGFRASV
CQTIGISSEEKFVITTTSRKEITCNNFDHTVKDGVTLYLLQSVDQSLLTATKERIDFLPH
YDTLVKSGMYEYYASEGQNPLPFALAELIDNSLSATSRNNGVRRIQIKLLFDETQGKPAV
AVVDNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPLPVPRSLNSDISYFGVGGK
QAVFFVGQSARMISKPIDSKDVHELVLSKEDFEKKEKNKEAIYSGYIRNRKPADSAHITN
DDERFLHNLIEEEKEKDSFTAVVITGVQPEHIQYLKNYLHLWTRQLTHIYHYYIHGPKGN
EISTAKAIGPFNNIDIEISLFEKGKTPKIINLREIQDDMQTLYINTASDSFEFKAHVEGD
GVVEGVIRYHPFLYDRETFPDDPCFPSKLKDEDDDDDCFISEKAARGKRPIFECFWNGRL
IPYTSVGDFDWCAPPKKRGLVPIECFNRISGALFTNDKFQVSTNKLTFMDLELKLKDKNT
LFTRILNGQEQRMKIDREFALWLKDCHEKHDKQIKFTLFKGIITRPDLPTKKQGPWATFS
AIEWDGKIYKAGQLVKTIKTLPLCYGSIVRFFLHGDHDGEVYATGGEVQIAMEPQALYDE
IKTVPIAKLDRTVAEKTIRKYVEDEMARLPDRLSVTWPEGDELLPNEVRPAGTPIGALRI
EILNKKGEAMQKLPGTSHGGSKKLLVELKVILHTSSGNKEIISHISQHGGKWPYWFKKME
NIQKLGNYTLKLQVVLNESNADTYAGRSLPSKVIKFSVKEGKPEKFSFGLLDSPFRVGVP
FNIPLELQDEFGHTTQLLSDIEPVLEASGLSLHYEGITKGPNCVIQGVVAKGPVNSCQGK
NFNLKVILPGLKEDSQILKIRLLPGPPHQLKVKPDSEVLVIENGTAFPFQVEVVDESDNI
TAQPKLIVHCKFLGAPNLPVYTVDCSSSGTSILTGSPIQVQNIKKDQKTLTARIEIPSCK
DVSPVEKTIKLLPSSHAACLQIFSVEEQKAIQIKHQDEVTWVAGDVIRNLIFQMYDEGER
EINITPSLAEKIKVNWTPEVNKEHLVQGLLPDVQVPTSVKDVRYCHVSFQDDHVCLESAF
TVRPLPDDPKHLKCELKGGKTVQMGQELQGEIVVIIADQYGNQISSFSPDSLSTLSITGD
GLDSSNLKITLEANSQSVSVQGIRFTPGPPGPKDLCFTWREFSDFLRVQLVSGPPTKLLL
MDWPELKESIPVINGRQLENPLIVQLCDQWDNPALVPNVKICLIKASSLRLLPSNQQHKT
DDKGRANLGVFTVCAPRGEHTVQVKGVYNKSTIEGPTIKLTILPDPEKPIRLNVKYDQDA
SFIAGDIFTDFMVSVISESGSVIKNINPTRISMKMWKLSSGMSRPPANAETFSCNKIKGN
DKEDGCFYFREKTIPNKVGAYCIQFDFMIDKTNILSSQQVIVDVLPNQPMKLVPDSQPAT
PAVSNVRSIASRTLVKDLRLSITDNYGNHTGMDLVGTVVATIKGFNEEDTDTPLFIGKVR
TLEFPFVKGSAEITTLVLAENSPGRDSTEYFIIFEPRLSTVSGTLESYSLPFMFYNDVKK
QQQMAALTKEKDELSKSITMYRSLFDANKQLVDEMKCQAEEAKLKETQLRNELKAYNIDI
PATQQTTHIEALLEKKITEQNELKKRPRRLCTLPNYTKRSGDILGKIAHLAQIEDDRAAM
VISWHLASDMDCVVTLTTDAARAIYDETQGRQQVLPLDSIYRKTLPDWKRPLPHFRNGKL
HFKPFGNPVFARDLLTFPDNIEHCETVFGMLLGDTIILDNLDAANHYRKEVVKITHCPTL
LTRDGDRIRSNGKFGGLQNKAPPMDKLRGMVFGAPVPKQCVVLGKQIDLIQQYRTALYRL
SSVNEDLDNQLQYLHTPDMKKKKQELDEQEKSLKRIEQKLGMTPVRRCNESLCHSPKIEV
TECPIPTKRMRRESTRQNRRPKGDVPN
NT seq 6024 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggagggcgccagcgatcccgccggcctctcggagggatctgggagagatggc
gccgtcgacggctgtaggacggtgtacttgtttgaccggcgcgggaaggactcggagcta
ggggatcgcgcactgcaggtctcggagcacgcggactacgcggggttccgcgcttctgtg
tgtcagacaattggcatttcatctgaagaaaagtttgttattacaactacaagtaggaaa
gaaattacctgtaataattttgaccacactgttaaagatggagtcactctgtacctgctg
cagtcagttgaccagtcactactgacggcgacgaaagaaagaattgactttctacctcac
tacgacactctagttaaaagtggcatgtatgagtattatgcgagtgaaggacagaatcct
ttgccatttgctcttgcagagttaatcgacaattcattgtcagctacttctcgaaataat
ggtgttaggagaatacagatcaaattgctttttgatgaaacacaaggaaaacctgctgtc
gcagtggtagataatggaagaggaatgacctctaagcagcttaacaactgggctgtgtat
aggctgtcaaaatttacaagacaaggtgactttgaaagtgatcactcagggtatgtccgg
ccattaccagtaccacgcagtttgaacagtgacatttcctattttggtgttggaggcaaa
caggctgttttctttgttgggcaatcagccagaatgataagcaagcctatcgactccaag
gatgttcatgagctggtgctttctaaagaagattttgagaagaaggaaaaaaataaagag
gcgatatatagtggatatattagaaacagaaagccagctgattctgctcacattacaaat
gatgatgaaagattcctacacaatcttattgaggaagagaaagagaaagacagctttaca
gctgtggttattacaggggtacagccagaacacatacagtacttgaaaaattatttacat
ctttggacacgacagctaacgcatatttatcattactatattcatggaccaaaaggaaat
gaaataagtacagccaaagccattggacctttcaacaatattgatattgaaatttctttg
tttgaaaaggggaagacacctaagattatcaacctaagggaaatacaagatgacatgcag
acattgtatataaacacagcgtctgatagttttgagttcaaggctcacgttgaaggagac
ggtgtagtggaaggggttatccggtaccatcccttcttatatgatagagaaacctttcct
gatgacccatgctttccatcaaagctaaaggatgaagacgacgatgatgactgtttcata
tccgagaaagcagctcgagggaagaggccgatctttgagtgtttttggaatggacggtta
ataccatatacatcagtaggagactttgactggtgtgctcctcctaagaagagagggctt
gtcccaattgagtgctttaatagaatatctggtgcattattcactaatgacaaatttcag
gtcagcacaaataaactgacatttatggatcttgagctgaaattgaaagataagaacacc
ctctttacaagaatcttaaatggacaggagcagagaatgaaaattgacagagaatttgct
ttatggctgaaggattgtcatgaaaagcatgacaaacaaataaaattcacgctttttaaa
ggaataattacccgtccagatcttcccactaaaaagcaaggcccctgggcaacattttca
gcaatagaatgggatgggaaaatatacaaagcaggccaactggtcaagacaatcaagaca
cttcctctctgttatggaagcattgttagatttttccttcatggtgatcatgatggagaa
gtgtatgcgacgggaggtgaagttcagattgccatggaaccccaggcactgtatgatgaa
ataaaaactgtgcccattgcaaagctggataggacagtagccgagaaaacaattaggaaa
tatgtagaagatgaaatggcaaggctccctgatagattgtctgtaacttggcctgaagga
gatgaattattgccaaatgaagttaggcctgctggaacaccaatcggtgcattaagaatt
gaaattctaaacaaaaagggggaagcaatgcagaaactcccagggacaagtcatggaggg
tcaaagaagctgctggtggaacttaaagtcatactgcacacttcaagtggaaataaagaa
atcatttcacatatcagtcagcatggagggaaatggccttactggtttaaaaaaatggaa
aatatccagaaactgggtaattatacattgaaattacaagttgtattgaatgaaagtaat
gcagatacctatgcaggaagatcactaccgtccaaagtaattaaattctctgttaaagag
ggcaagccagaaaagttttcgtttggtcttctggactctcctttccgtgttggagttcca
tttaatattcctctggagttacaggatgaatttggtcacactacccaactattgtctgat
attgagccagttcttgaagcaagtggtctgtctttacattatgaaggaataaccaaaggc
ccgaattgtgtaattcaaggtgtcgtagctaaaggtccagttaactcttgccagggcaag
aattttaatctgaaggttattcttcctggtttaaaagaagactcacagattttgaagatt
agattgctacctggtccccctcatcaactaaaggtgaaacctgactcagaagttctggtt
atagagaatggaacagctttcccatttcaggtggaagttgtggatgagtcagacaacata
acagcacaaccaaagctgatcgtccactgtaagtttctaggtgctccaaacctaccagtc
tatactgtggattgcagtagctctggaactagcatcctaacagggtcacccattcaagtt
cagaacattaagaaagaccagaagacactgaccgccaggattgagatacctagctgtaaa
gatgtgtcacctgttgaaaagacgatcaagttacttcccagtagccacgctgcttgcctg
cagatctttagtgtagaggagcaaaaggcgatccagatcaaacatcaggatgaggttact
tgggtagcaggtgatgtaatacgcaatctaatttttcaaatgtatgacgaaggagaaaga
gaaatcaatattacaccatccttggcagaaaaaattaaggttaattggactcctgaggtg
aacaaagaacatttggtacaaggtctccttcctgatgtgcaagtaccaacatctgtgaaa
gatgtccgctactgccatgtttctttccaagatgaccacgtgtgtctggagagcgccttt
acagtaagaccacttcctgatgatcccaaacatttaaaatgtgaattaaaaggaggaaaa
acagtgcagatgggccaagagcttcaaggagaaatagttgtaataattgcagatcagtat
ggaaatcagatttcatcattttcacctgattccttatctactttgtcgattactggagat
ggccttgacagctcaaacttgaaaatcaccttggaggccaactcacagagcgtaagtgtg
caaggcatcaggtttactccagggcctcctggacccaaggatctgtgttttacttggcga
gagttttctgactttctgcgcgtgcaactggtttctggacctccaaccaagctgctgctt
atggactggccagagctgaaagagtccattcctgtgattaatggaagacaattagagaac
cctctcattgttcaactttgtgatcagtgggataatcctgctttagtcccaaacgttaaa
atatgtctcataaaagcaagcagcttaaggctactaccttcaaaccagcagcataaaaca
gatgataagggcagagctaatttgggggtgttcactgtttgtgctccaaggggagaacac
actgtgcaggttaaaggtgtctataataagagcactatagaagggcctacaattaagtta
acaattcttccagaccctgaaaagcccattcgcctcaatgttaaatatgaccaagatgcc
tcttttatagcaggggacatattcactgattttatggttagtgtgatttctgaaagtggt
agtgtcatcaaaaatattaatccaacacgtatttccatgaaaatgtggaagctgtccagt
ggcatgagccggccaccagcaaatgcagaaacctttagttgtaataaaataaaaggtaac
gacaaggaagatggctgcttctatttcagggagaaaactatccctaacaaggtgggagca
tattgtatccagtttgatttcatgattgataagacaaatattctaagcagccaacaggtt
atagttgatgttctccccaaccagcctatgaagttggttcctgacagccaaccagctacc
ccagctgtttctaatgtccgttcaattgccagcaggaccttggtcaaagacctgcgcctc
agtatcacagataattatggtaatcacactggaatggatctggttggcactgtagtagca
accattaaaggctttaatgaggaggacactgataccccactcttcatcgggaaggttagg
acgcttgagtttccctttgtgaaaggctctgctgaaatcacgactctagtgctggcagaa
aatagtcctggaagggatagtactgaatactttattatctttgagcctcggctgtcaact
gtatcaggaacattagaatcatatagcctgccatttatgttttacaatgatgttaagaag
cagcaacaaatggcagcgcttacgaaggagaaggacgagttatccaagtccatcactatg
tacagaagtctcttcgatgccaacaagcagcttgtggatgaaatgaaatgccaagctgaa
gaagcaaagttaaaagagacccagctacgaaatgaactaaaagcgtacaatattgatatt
cctgcgacacaacagacaactcatattgaagcacttttggaaaaaaagataacagaacag
aacgagcttaaaaagaggcccagaaggttgtgtactcttccaaactacactaaacgcagt
ggagatattttgggaaagattgcacatctagcacaaattgaagatgatcgagctgccatg
gttatctcttggcatctggcaagtgacatggactgtgtggttaccctaaccactgatgcc
gcacgcgctatctatgacgaaactcaaggtcgccagcaagtgttgccccttgattctatt
tacaggaaaactcttccagattggaaaagacctctacctcatttccgaaatggtaaatta
cactttaagccctttggaaatccagtctttgcccgagatttgttaacattcccagataat
attgaacattgtgaaacagtttttggtatgctgttaggagacaccattattttggataat
ctggatgcagccaatcattatagaaaagaggttgttaaaatcacacactgccccacactc
ctgactagagatggagatagaattagaagtaatgggaagtttgggggccttcagaataaa
gctccgccaatggacaaacttcggggaatggtcttcggagctccagtaccaaagcagtgt
gtggtcttggggaaacaaatagatcttattcagcagtatcgcactgctctgtacaggctg
agctctgtgaacgaggacttggacaatcagctgcagtaccttcacactcctgatatgaag
aagaaaaagcaagaacttgatgaacaggaaaaaagtctgaaacgaatagagcagaaactc
ggaatgactcctgtgcgcaggtgtaatgagtcactttgtcactcaccaaagattgaggtg
acagagtgcccaatccctactaaaagaatgagaagagaatccaccagacagaatagaagg
ccaaaaggtgacgtaccaaactga

DBGET integrated database retrieval system