KEGG   Mus musculus (mouse): 74370Help
Entry
74370             CDS       T01002                                 

Gene name
Rptor, 4932417H02Rik, Rap, Raptor, mKIAA1303
Definition
(RefSeq) regulatory associated protein of MTOR, complex 1
  KO
K07204  regulatory associated protein of mTOR
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    74370 (Rptor)
   04152 AMPK signaling pathway
    74370 (Rptor)
   04150 mTOR signaling pathway
    74370 (Rptor)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    74370 (Rptor)
   04136 Autophagy - other
    74370 (Rptor)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    74370 (Rptor)
  09149 Aging
   04211 Longevity regulating pathway
    74370 (Rptor)
   04213 Longevity regulating pathway - multiple species
    74370 (Rptor)
  09159 Environmental adaptation
   04714 Thermogenesis
    74370 (Rptor)
 09160 Human Diseases
  09161 Cancers: Overview
   05206 MicroRNAs in cancer
    74370 (Rptor)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    74370 (Rptor)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    74370 (Rptor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT HEAT_2 WD40 Cnd1 HEAT_EZ
Motif
Other DBs
NCBI-GeneID: 74370
NCBI-ProteinID: NP_001293010
MGI: 1921620
Ensembl: ENSMUSG00000025583
Vega: OTTMUSG00000004025
Position
11; 11 E2
AA seq 914 aa AA seqDB search
MGVENRSPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQ
SSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAV
IVNSYTTGQEACLQGNLIAICLEQLSDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAH
EKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPMVRK
ELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPAATEGGSLTPVRDSPCTPRLRSVS
SYGNIRAVTTARNLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILSF
ETIDKMRRVSSYSALNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYKA
TVNARPQRILDTSSLTQSAPASPTNKGMHMHQVGGSPPASSTSSCSLTNDVAKQTVSRDL
PSSRPGTAGPTGAQYTPHSHQFPRTRKMFDKGPDQTTDDADDAAGHKSFICASMQTGFCD
WSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRKQAQQVIQKGITRLDDQIFLNR
NPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDC
SLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSS
GDVRIVRIWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSE
CRVMTYREHTAWVVKAYLQKHPEGHIVSVSVNGDVRFFDPRMPESVNVMQIVKGLTALDI
HPQANLIACGSMNQFTAIYNGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSN
DYYISVYSVEKRVR
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtggaaaacaggagccccccagagcagctgcccatcgtcctgcaggtgctgcta
agccaggtgcaccggctgagagcattggacttgctgggacggtttttggacttgggccct
tgggcggtgagcttggccctgtcggtgggcatcttcccctatgtactgaagctgcttcag
agctcagcccgagagcttcggccactccttgtcttcatctgggccaaaatcctcgctgtc
gacagttcgtgccaagctgacctcgtgaaggacaacggtcacaagtacttcctatccgtc
ttggcagacccatacatgccagctgaacataggaccatgacagccttcattcttgctgta
atcgtcaacagctacacaacagggcaagaggcctgcctccagggaaacctgattgccatc
tgtctggagcagctcagcgacccacaccccttgctacgccagtgggtggccatttgcctg
ggaaggatctggcagaacttcgactctgcaagatggtgtggggtgagagacagtgcccac
gaaaagctctatagcctcctctctgaccccatccctgaggtccgatgtgcagctgtattt
gccctgggcacctttgtgggaaattctgctgagaggacagaccactctaccaccattgac
cacaatgtggccatgatgctggctcagctgatcaatgatggaagccccatggtccggaag
gagctggtggtggctctgagtcaccttgtagtccaatatgaaagcaatttctgcactgtg
gccctgcagttcatggaggaagaaaagaactaccctttgccttctccagcagccacagag
ggagggagcttgaccccagttcgagacagcccatgcacccccagactccgttcagtgagc
tcctatgggaacatccgagccgtcacgacagctaggaacctgaacaaatctttgcagaat
ctgagcttgacggaagaatcgggcagctcagtggccttctctcccgggaacctcagcacc
agcagcagtgccagcagcaccttggggagccctgagaacgaggagtacatcctgtccttc
gagaccatcgacaagatgcggcgtgtgagctcctactcagcgctcaactccctcatagga
gtttcttttaatagtgtttacactcaaatttggagagtcttactgcatctggctgctgat
ccctatccagatgtttctgatttagccatgaaagtcctcaacagcattgcttacaaggcc
acagtgaacgcccggccccaacgaatccttgacacatcctctctcacacagtcggcccca
gccagcccaaccaacaagggcatgcacatgcaccaggtgggaggctccccgccagcatct
agcaccagcagctgcagcctgaccaatgatgtggccaagcagactgtcagccgtgacctg
ccttccagccgcccgggtactgccggccccacaggggcacagtacacccctcactcccac
cagttccctcgaacacgaaagatgtttgacaaaggccctgatcagaccacagatgatgca
gatgatgctgccggacacaagagcttcatttgtgcctctatgcagacagggttctgtgac
tggagtgcccgctactttgcccagccagtcatgaagatccccgaggagcatgacctagag
agtcagatccgcaaggagcgtgagtggcggttcctgaggaacactcgagtcaggaagcag
gctcagcaggtcatccagaagggcatcaccagactggacgatcagatctttctgaacagg
aaccccggcgttccttctgtggtcaaattccatccctttacaccatgcatagctgtcgcc
gacaaggacagcatctgtttttgggactgggagaaaggagagaagctggactatttccac
aatggcaaccctcggtacaccagggtcaccgccatggagtacctgaatggtcaggactgt
tccttgctgctgacagccacagatgatggtgccatcagggtctggaagaattttgctgat
ttggaaaagaatccagagatggtgactgcgtggcaagggctctcagacatgcttccaaca
acacgaggagctgggatggtggtagactgggaacaagaaactggccttctcatgagctca
ggggacgtgcgcattgtcaggatctgggatactgaccgggagacgaaggtgcaggacatc
cccacgggtgctgacagctgtgtgacaagtctgtcttgtgattcgcaccgttcgctcatt
gtggctggcctgggtgatggctcgatccgtgtctacgacaggaggatggcactcagtgaa
tgccgggtcatgacttaccgagagcacacagcgtgggtggtaaaggcctacctgcagaag
caccctgagggccacatcgtgagtgtgagtgtcaatggagatgtgcgcttcttcgaccct
cggatgcccgagtctgtgaatgtaatgcagattgtgaaggggctgacagccctggacatc
cacccccaggcaaacctgatcgcctgtggctccatgaaccagttcacagccatctacaac
ggaaatggagagctgatcaacaacatcaaatactatgatggcttcatgggccagcgagtc
ggggccatcagctgcctggctttccacccacactggcctcatctggccgtaggaagcaat
gactactacatttccgtgtattcggtggagaagcgtgtcagatag

DBGET integrated database retrieval system