KEGG   Mus musculus (mouse): 74374Help
Entry
74374             CDS       T01002                                 

Gene name
Clec16a, 4932416N17Rik, curt, mKIAA0350
Definition
(RefSeq) C-type lectin domain family 16, member A
  KO
K19513  protein CLEC16A
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    74374 (Clec16a)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    74374 (Clec16a)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    74374 (Clec16a)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    74374 (Clec16a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FPL PIEZO
Motif
Other DBs
NCBI-GeneID: 74374
NCBI-ProteinID: NP_808230
MGI: 1921624
Ensembl: ENSMUSG00000068663
Vega: OTTMUSG00000023673
UniProt: Q80U30
Position
16; 16 A1
AA seq 1036 aa AA seqDB search
MFGRSRSWVGGGHSKSSRNIHSLDHLKYLYHVLTKNTTVTEQNRNLLVETIRSITEILIW
GDQNDSSVFDFFLEKNMFVFFLNILRQKSGRYVCVQLLQTLNILFENISHETSLYYLLSN
NYVNSIIVHKFDFSDEEIMAYYISFLKTLSLKLNNHTVHFFYNEHTNDFALYTEAIKFFN
HPESMVRIAVRTITLNVYKVSLDNQAMLHYIRDKTAVPYFSNLVWFIGSHVIELDNCVQT
DEEHRNRGKLSDLVAEHLDHLHYLNDILIINCEFLNDVLTDHLLNRLFLPLYVYSLENPD
KGGERPKISLPVSLYLLSQVFLIIHHAPLVNSLAEVILNGDLSETYTKPAQDVPRSSAKP
SIRCFIKPTETLERSLEMNKHKGKKRMQKRPNYKNVGEEEDEERGSAEDAQEDAEKTKEI
EMVIMKLGKLSEVAAAGTSVQEQNTTDEEKSAATNSENAQWSRPFLDMVYHALDSPDDDY
HALFVLCLLYAMSHNKGMDPEKLKRIQLPVPSEAEKTTYNHLLAERLIRIMNNAAQPDGR
IRLATLELSCLLLKQQVLTSSGCVIKDVHLACLEGAREESVHLVRHFYKGEEIFLDMFED
EYRSMTIKPMNVEYLMMDASILLPPTGTPLTGIDFVKRLPCGDVEKTRRAIRVFFMLRSL
SLQLRGEPETQLPLTREEDLIKTDDVLDLNNSDLIACTVITKDGGMVQRFLAVDIYQMSL
VEPDVSRLGWGVVKFAGLLQDMQVTGVEDDSRALNITIHKPASSPHSKPFPILQATFVFS
DHIRCIIAKQRLAKGRIQARRMKMQRIAALLDLPIQPTTEVLGFGLCSSSSSSQHLPFRF
YEQCRRGSSDPTVQRSVFASVDKVPGFAVAQCINQHSSPSLSSPSPPFASGSPGGSGSTS
HCDSGGSSSAPSATQSPADAPTTPEQPQPHLDQSVIGNEMDVNSKPSKNSSARSSEGETM
HLSPSLLPAQQPTISLLYEDTADTLSVESLTIVPPVDPHSLRALSGISQLPTLPAADTET
PAEGAVNPEPAEPTEH
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atgtttggacgctcacggagctgggtgggcgggggccacagcaagtcctcccgcaacatc
cactccttggaccacctgaagtacctgtaccatgttttaacaaaaaacaccactgtcaca
gaacaaaatcggaacctgctcgtggagaccatccgttccatcactgagatcctgatttgg
ggcgatcaaaatgacagctctgtgtttgacttcttcctggagaagaatatgtttgttttc
ttcttgaacattctgcggcagaaatcaggccgttatgtgtgtgtgcagctgctacagacc
ttgaacattctctttgagaacatcagccacgagacatcgctctattatttgctgtctaat
aactatgtaaactcgatcattgtccataaatttgacttttccgacgaggagatcatggcg
tattacatatcgttcctgaaaacgctttcattaaagctcaacaaccacactgtccatttc
ttttacaatgagcacaccaatgactttgccctgtacacagaagccatcaagttcttcaat
catcccgaaagcatggttcgaattgccgtgagaaccatcactttgaatgtctacaaagtg
tcattggataaccaggccatgctgcactacatcagagacaaaaccgctgtcccgtacttc
tccaatttggtctggttcattgggagccatgtgatcgaacttgacaactgtgtgcagaca
gatgaggagcaccggaatcgggggaaactgagtgacctggtggctgagcacttggaccac
ctgcactatctcaacgacatcctgatcatcaactgcgagttcctcaatgacgtactcacc
gaccacctgctcaacaggcttttcctgccgctctacgtgtactccctggagaaccccgac
aagggaggagaacggccaaaaatcagcctgcctgtgtccctctatcttctctcccaggtc
ttcctcattatacatcacgccccgctggtgaactctctggctgaagtcattctgaatggt
gatctatctgagacatacacaaagcctgcacaggatgttcccagaagttctgccaagccc
agcatccggtgcttcattaagcccactgagacactcgagcggtcccttgagatgaacaag
cacaagggcaagaagcggatgcaaaagagacccaactacaaaaacgttggggaggaggag
gacgaggagagagggtctgctgaagatgcccaggaagacgctgagaagactaaagagatt
gagatggtgatcatgaagcttggcaagctctcagaggtggccgctgctgggacctcagtg
caggagcagaacaccacagacgaggagaagagcgccgccacgaactcagagaatgcacag
tggagcagacccttcctggatatggtgtaccatgccctggacagccctgacgatgactat
cacgccctcttcgtgctctgcctcctgtatgccatgtctcataacaaaggcatggatcct
gaaaaactaaaacgaattcagctcccagtgccaagtgaagctgagaaaaccacctacaac
catctgctggccgagaggctcatcaggatcatgaacaatgctgctcagccagatggcagg
atccggttggctacactggagctgagctgcctgctcctgaagcagcaagtactgaccagc
tctggctgtgtcatcaaggatgtgcacctggcctgtttggagggtgcaagagaagagagt
gtccaccttgtacgtcatttctataagggagaagagattttcttggacatgtttgaagat
gagtacaggagcatgacaataaagcccatgaatgtggagtatctcatgatggatgcttcc
atcctcctgcccccaacgggcactccactgactggcattgactttgtgaagcggctgcca
tgtggtgatgtggagaagacgaggcgggccatccgggtattcttcatgctgcgttccctg
tcactgcagctgcgaggggaacctgagacccagttgccactgactcgggaggaggacctg
atcaaaacagatgatgtcttggatctgaataacagtgacttgattgcatgcacagtcatc
accaaggatggtggtatggtccagcggttcctggctgtggacatttaccagatgagcctg
gtggagcctgacgtatccagacttggctggggagtggtcaagtttgctggccttctacag
gacatgcaggtgacaggagtggaggatgacagccgtgccctgaacatcaccattcacaag
cctgcctccagcccgcactctaagcccttccctatcctgcaggccaccttcgtgttctcg
gatcatatccgctgcattattgccaagcagcgcctggccaagggccgcatccaggccagg
cgcatgaagatgcagaggatagccgcccttctggacctcccaatccagccgacaacagaa
gtcctgggatttggactctgctcctcctcctcctcctcccagcacctgcctttccgtttc
tatgagcagtgccgcagaggcagcagtgacccgacagtgcaacgctctgtgtttgcatcc
gtagacaaggtgccaggctttgctgtggcccagtgcataaaccagcatagctctccatcc
ctgtcatcaccgtcgccaccatttgccagtgggagccctggtggcagtggaagcaccagc
cactgtgactcaggaggctcttcctctgcaccctcagcaacccagagcccggcagatgcc
cccacgactccagaacagcctcagcctcacctagaccagtcagtgattgggaatgaaatg
gatgtcaactccaagcccagcaagaactcatcggccaggagctctgagggggagacaatg
cacctgtcccctagcctccttcccgcccagcagcccaccatctccttgctctacgaggac
actgctgacacactgagtgtcgagtcactgaccattgtccccccggtcgatccccacagc
ctccgagccctctctggcatctcccagctccccacactgcctgcagcagatacggagacc
ccagctgagggtgctgtaaacccagagcctgcggaacccacagagcactga

DBGET integrated database retrieval system