KEGG   Mus musculus (house mouse): 74377
Entry
74377             CDS       T01002                                 
Symbol
Hsf2bp, 4932437G14Rik, Meilb2
Name
(RefSeq) heat shock transcription factor 2 binding protein
  KO
K25791  heat shock factor 2-binding protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    74377 (Hsf2bp)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     74377 (Hsf2bp)
SSDB
Motif
Pfam: DUF383 MutS_III
Other DBs
NCBI-GeneID: 74377
NCBI-ProteinID: NP_083178
MGI: 1921627
Ensembl: ENSMUSG00000002076
UniProt: Q9D4G2 A0A3T0ZJB3
Position
17:complement(32163743..32253869)
AA seq 338 aa
MAATVGDGSGTEEACRNMESKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGELLESFQK
LKMVEKNLERKEQELEQLIMDREHFKARLETAQADSGREKKEKLALRQQLNEAKQQLLQQ
AEYCTQMGAVTCTLLWGVSSSEEVVKTILGGDKALKFFNITGQTMESFVKSLDGDVKEVD
SDENQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTMLQLLGDLKPGQCTKLKVLMLMS
LYNVSINSKGLKYITESPGFIPLLWWLLSDPDAEVCLHTLRLIQSVVLEPDVFSKVASEL
QSSLPLQRILAMSKSRNSHLQSAAQELLEDLRALDCNV
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggccgcaaccgtgggcgacgggtccggtactgaggaggcctgccggaacatggaatct
aaagaagaatttgttaaagtcagaaagaaggacctggaacggctgacgacggaagtgatg
caaatacgggacttcttacccagaatactaaatggggagttactggaaagtttccagaaa
ttaaagatggtagaaaaaaacctggaaagaaaagaacaagaattagagcaactgataatg
gaccgtgaacacttcaaagcccggctagaaactgcacaggcagacagtgggagggagaag
aaggagaagttggctcttcgacagcagctgaatgaggcaaaacagcagctcctccagcag
gcagagtattgcacacaaatgggagctgtcacctgtaccctcctctggggggtttccagc
agcgaggaggtcgtcaaaaccattctaggaggagacaaagcattgaagtttttcaacata
actggccagacgatggagagttttgtgaagtcattggatggggatgtcaaggaggttgat
tctgatgaaaatcaatttgtctttgcactggctggaattgtaacaaatgttgccgccatt
gcgtgtggtcgtgaattcttggtgaattccagccgggtgctcctggacaccatgttgcag
ctgctgggggacttaaagcctggccagtgcaccaaactcaaagttctaatgctgatgtcc
ctgtataatgtgagcatcaattcaaaaggcttgaaatacatcactgagagtcctggattt
atccctttgctgtggtggcttttgagtgatccagacgcggaagtgtgtcttcataccctg
cggctcatccagtctgtggttctagaaccagacgtcttctccaaggtggcctctgagctc
cagagctccttacccttgcagcgcatcctggccatgtccaagagccgcaactcccacctg
cagtctgctgcccaggagctcctggaagacctccgcgccctggactgtaatgtttag

DBGET integrated database retrieval system