KEGG   Mus musculus (mouse): 74377
Entry
74377             CDS       T01002                                 

Gene name
Hsf2bp, 4932437G14Rik, Meilb2
Definition
(RefSeq) heat shock transcription factor 2 binding protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF383 MutS_III
Other DBs
NCBI-GeneID: 74377
NCBI-ProteinID: NP_083178
MGI: 1921627
Ensembl: ENSMUSG00000002076
Vega: OTTMUSG00000031368
UniProt: Q9D4G2 A0A3T0ZJB3
Position
17; 17 B1
AA seq 338 aa
MAATVGDGSGTEEACRNMESKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGELLESFQK
LKMVEKNLERKEQELEQLIMDREHFKARLETAQADSGREKKEKLALRQQLNEAKQQLLQQ
AEYCTQMGAVTCTLLWGVSSSEEVVKTILGGDKALKFFNITGQTMESFVKSLDGDVKEVD
SDENQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTMLQLLGDLKPGQCTKLKVLMLMS
LYNVSINSKGLKYITESPGFIPLLWWLLSDPDAEVCLHTLRLIQSVVLEPDVFSKVASEL
QSSLPLQRILAMSKSRNSHLQSAAQELLEDLRALDCNV
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggccgcaaccgtgggcgacgggtccggtactgaggaggcctgccggaacatggaatct
aaagaagaatttgttaaagtcagaaagaaggacctggaacggctgacgacggaagtgatg
caaatacgggacttcttacccagaatactaaatggggagttactggaaagtttccagaaa
ttaaagatggtagaaaaaaacctggaaagaaaagaacaagaattagagcaactgataatg
gaccgtgaacacttcaaagcccggctagaaactgcacaggcagacagtgggagggagaag
aaggagaagttggctcttcgacagcagctgaatgaggcaaaacagcagctcctccagcag
gcagagtattgcacacaaatgggagctgtcacctgtaccctcctctggggggtttccagc
agcgaggaggtcgtcaaaaccattctaggaggagacaaagcattgaagtttttcaacata
actggccagacgatggagagttttgtgaagtcattggatggggatgtcaaggaggttgat
tctgatgaaaatcaatttgtctttgcactggctggaattgtaacaaatgttgccgccatt
gcgtgtggtcgtgaattcttggtgaattccagccgggtgctcctggacaccatgttgcag
ctgctgggggacttaaagcctggccagtgcaccaaactcaaagttctaatgctgatgtcc
ctgtataatgtgagcatcaattcaaaaggcttgaaatacatcactgagagtcctggattt
atccctttgctgtggtggcttttgagtgatccagacgcggaagtgtgtcttcataccctg
cggctcatccagtctgtggttctagaaccagacgtcttctccaaggtggcctctgagctc
cagagctccttacccttgcagcgcatcctggccatgtccaagagccgcaactcccacctg
cagtctgctgcccaggagctcctggaagacctccgcgccctggactgtaatgtttag

DBGET integrated database retrieval system