KEGG   Mus musculus (house mouse): 74407
Entry
74407             CDS       T01002                                 
Symbol
Odad4, 4933404O19Rik, Ttc25
Name
(RefSeq) outer dynein arm complex subunit 4
  KO
K24254  outer dynein arm-docking complex subunit 4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    74407 (Odad4)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  ODA docking complex
   74407 (Odad4)
SSDB
Motif
Pfam: TPR_12 TPR_1 TPR_2 TPR_8 TPR_7 RPN7 TPR_MalT TPR_19 ANAPC3
Other DBs
NCBI-GeneID: 74407
NCBI-ProteinID: NP_083194
MGI: 1921657
Ensembl: ENSMUSG00000006784
UniProt: Q9D4B2
Position
11:100436434..100463392
AA seq 624 aa
MSDGDILRSTFPSYMAEGERLYLCGEFTKAIQSFTNALHLQSGDKNCLVARSKCYLKMGD
LEKSLNDAEASLRNDPTFCKGILQKAETLYTMGDFEFALVFYHRGYKLRPDREFKVGIQK
AQEAINNSVGSPSSIKLENKGDLSFLSKQAESKKAQQKHLPIKQLSYSTKHEIKRKGSLK
SEKTVRQLLGELYVDKEYLEKLLLDEDLIKGTIKSGLTVEDLIMTGINYLDTRSNFWRQQ
KPIYARERDRKLMQEKWLRDRKRSPSQTAHYILKSLEDIDMLLTSGSADGSLQKAEKVLK
KVLEWNQEEVPNKDELVGNLYSCIGNAQIELGQMVAALQSHRKDLEIAKEHDLPDAKSRA
LDNIGRVFARVGKFQQAIDTWEEKIPLAKTTLEKTWLFHEIGRCYLELDQAWQAQSYGEK
SQQYAEEEGDLEWQLNASVLVAQAQVKLRDFESAVNNFEKALERAKLVHNNEAQQAIISA
LDDANKGIIEELKKTNYREILREKAERQDIMSQMDLQGASEKEPLRGREEQERVVKQWER
DQESEREATDDEQDRKSSGGLSKKLLGDGHSSNLGIRRESREIYRRLSDYSSHLPSEDGS
QKQEKKQAEAAKGEVQKLEKTKEE
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgtcggacggtgatatcttaagaagcacttttccctcttacatggcagagggggagagg
ctttatctgtgcggggagttcactaaggccattcaaagctttaccaacgctcttcacctt
caaagtggagataagaactgcctggttgcccgctccaaatgctacctgaagatgggagac
ttagagaagtccttgaacgatgctgaggcctcacttcggaacgacccgactttctgcaag
gggatcttacagaaggctgagacactgtacaccatgggagactttgagtttgccctggtg
ttctatcatcgaggctacaaactgagacctgatcgggaattcaaagtaggaattcagaag
gcccaggaagccatcaacaactcggtgggaagtccttcttcaatcaagctggagaacaaa
ggcgacctctccttcttaagcaagcaagctgagagtaagaaagcccaacagaagcatctg
cctataaagcaactctcgtacagcaccaagcatgaaatcaagcggaagggctcgctcaag
agcgagaagaccgtgcggcagctgctcggggagctgtacgtggacaaggagtatctggag
aagctccttctggatgaagatctcatcaaaggcaccatcaagagtggcctgaccgtggag
gacctcattatgactggcatcaactacctggacacccgcagcaacttctggaggcagcag
aagcccatctatgccagggagcgagaccggaagctgatgcaagagaagtggctgagggac
cggaaacgcagcccctcgcagacagcccactacatcctcaagagcctagaggacattgac
atgttgttgaccagtggcagtgctgatgggagcctccaaaaagctgagaaagtccttaag
aaggttctggaatggaaccaagaggaggtacccaacaaggacgagctggtcgggaacttg
tacagctgcataggcaacgcccagattgagctggggcagatggtggctgccttgcagagc
caccgaaaggacctggagatcgccaaggaacatgaccttccagatgcaaaatcgagagcc
cttgacaatattggcagagtttttgccagagttgggaaattccagcaagccattgacacg
tgggaggagaagatccctctagccaaaaccaccctggagaagacctggctcttccacgag
attggccgctgttacttggagctggaccaggcgtggcaggcccagagttatggggaaaag
tctcagcagtacgctgaggaggaaggggacctcgagtggcagctgaacgccagtgtcctg
gtggcgcaggcccaagtgaagctgagagacttcgagtcagctgtgaataactttgagaag
gccctggagagagccaagctggtccacaacaacgaggcgcagcaggccatcatcagcgcc
ttggacgatgccaacaagggcatcatcgaagaacttaagaaaacgaactacagggagata
ctcagggaaaaggcagagagacaggacatcatgtcacagatggatttgcagggagcatct
gagaaggagccgctgcgagggcgagaggagcaggagagggtggtgaagcagtgggagagg
gaccaggaaagtgagagagaagccacggatgacgagcaagacaggaaaagctcgggagga
ctcagcaaaaaactgttgggagacggtcactcgtcaaacctagggattaggagagagtcc
agagaaatctacagaaggctctcggactactccagccacctaccctcagaggacggcagc
caaaaacaagagaagaaacaagcagaagcagccaaaggggaggtccaaaagttggagaag
acaaaagaggaataa

DBGET integrated database retrieval system