KEGG   Mus musculus (mouse): 74414
Entry
74414             CDS       T01002                                 

Gene name
Polr3c, 4933407E01Rik, RP, RPC, RPC3, RPC62
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide C
  KO
K03023  DNA-directed RNA polymerase III subunit RPC3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    74414 (Polr3c)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    74414 (Polr3c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    74414 (Polr3c)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     74414 (Polr3c)
SSDB
Motif
Pfam: RNA_pol_Rpc82 HTH_9 NIT
Other DBs
NCBI-GeneID: 74414
NCBI-ProteinID: NP_083201
MGI: 1921664
Ensembl: ENSMUSG00000028099
Vega: OTTMUSG00000033832
UniProt: Q9D483 B2RX77
Position
3; 3 F2.1
AA seq 533 aa
MTQAEIKLCSLLLQEHFGEIVEKIGVHLVRTGSQPLRVIAHDTKASLDQVKKALCVLIHH
NLVLYHVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYGDTGELIVEELLLNGKMTMSA
VVKKVADRLTETMEDGKTMDYAEVSNAFVRLADTHFVQRCPLVPDTDSSDRGPPPPAPTL
VINEKDMYLVPKLSLIGKGKRRRSSDEDATGEPKAKKPRYTDNKEPSPDDGIYWQVNLDR
FHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTPSSAPYTQPLSSNEIFRSLPVGY
NISKQVLDQYLTLLADDPLEFIGKSGDSGGGMFVINLHKALASLATATLESVIQERFGSR
CARIFRLVLQKKHLEQKQVEDFAMIPAKEAKDMLYKMLSENFILLQEIPKTPDHAPSRTF
YLYTVNVLSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIMASMQATGAEE
VQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIESTMKRQ
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgactcaagcagagattaaactgtgttctttgttgctgcaagagcattttggtgagatt
gtagaaaaaattggagtccacctagtcagaactggaagccagccacttagagtaattgcc
cacgacacaaaagcatccctggaccaggtgaaaaaagccctttgtgtcctcattcaccac
aacctggtcctctatcatgtgcacaagcgcggtgtggtggagtatgaagcccagtgcagc
cgggtactgaggatgcttaggtatccccggtacatctacaccaccaaaacgctgtacggt
gacaccggagagctgattgttgaggagctcctgctgaatggcaaaatgacaatgtcagct
gttgtgaagaaagtagccgaccgactcacagagaccatggaggatggcaagaccatggac
tacgctgaggtatcaaatgcatttgtgcgactggcagatactcactttgtacagcgctgt
cccctggttcctgacactgacagttctgaccgtgggccaccgccacccgccccaaccctt
gtcattaatgaaaaggacatgtacctagttcccaaactgagcttgataggaaaaggtaag
aggaggagatcatctgatgaagatgctactggagagcccaaggccaagaaaccaagatac
acagataacaaggagccctcaccagacgatgggatttattggcaagtcaacctcgacagg
ttccaccagcacttccgtgaccaagcaatcgtgagcgcagtggcaaaccgaatggaccag
acaagcagcgagatcgtgcggacgatgctccggatgagtgagatcaccactccctctagc
gccccctatactcagccgctgtcctccaatgagatcttcaggtccctgcccgtcggatat
aacatctctaaacaggttctcgatcagtacctcacgctgctggcagatgacccactagag
tttattggaaagtctggcgacagtggcggaggaatgtttgtcatcaacctccataaagca
ttagcgtccctagccactgcaactctggagtctgtcatccaggagagattcgggtctcgc
tgtgccaggatattccgtctggtattgcagaagaaacaccttgagcagaagcaggtggag
gactttgcaatgatccctgcgaaggaggcaaaggacatgctgtacaagatgctctcggaa
aacttcatcctgctgcaggaaattcctaagacgccagaccacgccccgtccaggaccttc
tatctgtacactgtgaatgtgctctcagctgccaggatgctgttgcacaggtgctataag
agcatagccaacttgatagaacggcgacagtttgaaacaaaggagaacaagcggctacta
gaaaagtctcagcgggtggaagccatcatggcatccatgcaggccacgggtgcagaggag
gtgcagctgcaggagatagaggagatgatcacagcccccgagcggcagcagctggagaca
ctgaaacgcaacgttaacaagttggacgccagtgagatccaggtggatgaaaccatcttc
ttactggaatcatacattgagagcaccatgaagaggcagtga

DBGET integrated database retrieval system