KEGG   Mus musculus (mouse): 74440Help
Entry
74440             CDS       T01002                                 

Gene name
Cmip, 4933407C03Rik, 5830471E12Rik, AI314065, AI464126
Definition
(RefSeq) c-Maf inducing protein
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_8 PH Microtub_bd
Motif
Other DBs
NCBI-GeneID: 74440
NCBI-ProteinID: NP_001156734
MGI: 1921690
Ensembl: ENSMUSG00000034390
Vega: OTTMUSG00000061721
UniProt: Q9D486
Position
8; 8 E1
AA seq 773 aa AA seqDB search
MDVTSSSGGGDPRQIEETKPLLGSDVSGPEGTKVMGAVPCRRALLLCNGMRYKLLQEGDI
QVCVIRHPRTFLSKILTSKFLRRWEPHHLTLADNSLASATPSGYMENSVSYSAIEDVQPL
SWENAPKYCLQLTIPGGTVLLQAANSYLRDQWFHSLQWKKKIYKYKKVLSNPSRWEVVLK
EIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQEHENIIVAIAPLLENNHPPP
DLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHNMDFGKCPRLRLFTQEYILALNELNAG
MEVVKKFIQSMHGPTGHCPHPRVLPNLVAVCLAAIYSCYEEFINSRDNSPSLKEIRNGCQ
QPCDRKPTLPLRLLHPSPDLVSQEATLSEPRLKSVVVASSEVHVEVERTSTAKPALTAST
GNDSEPNLIDCLMVSPACGTMSIELGPQAGRTLGCHVEILKLLSDYDDWRPSLASLLQPI
PFPKEALAHEKFTKELKYVIQRFAEDPRQEVHSCLLSVRAGKDGWFQLYSPGGVACDDDG
ELFASMVHILMGSCYKTKKFLLSLAENKLGPCMLLALRGNQTMAEILCLMLEYNIIDNND
TQLQIISTLESTDVGKRMYEQLCDRQRELKELQRKGGPTRLTLPSKSTDADLARLLSSGS
FGNLENLSLAFTNVTSACAEHLIKLPSLKQLNLWSTQFGDAGLRLLSEHLTMLQVLNLCE
TPVTDAGLLALSSMKSLCSLNMNSTKLSADTYEDLKAKLPNLKEVDVRYTEAW
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgacgagcagctcgggcggcggcgacccccggcagatcgaggagaccaagccg
ctgcttgggagcgacgtgtctggccccgagggcaccaaggtgatgggcgccgtgccttgc
cgccgggccctgctgctttgcaacgggatgaggtacaagctgctgcaggagggcgacatt
caggtctgtgtcatccggcaccctcggacctttctcagcaagatcctcacctccaaattc
ctgaggcgctgggagccgcaccacctaacgctggccgacaacagcttagcatccgccacg
ccgtctgggtacatggaaaactcggtctcctacagcgccattgaagacgttcagccgctg
tcctgggagaacgccccgaagtactgtttacagctcacgatccccggagggaccgtcctg
ctgcaggctgccaacagctacctgcgagatcagtggttccattctctgcagtggaagaaa
aagatttacaaatacaagaaagtcctgagtaacccaagccgctgggaggttgtcttgaag
gagatacggacgctggtggacatggccctcacgtcgcctctgcaggatgattctatcaac
caggctccgctggaaatcgtctcaaaactgctctcagagaacacaaacctgaccactcag
gagcacgagaacatcattgtggcaattgcgcctctgctagaaaacaaccacccaccccca
gacctctgcgaattcttctgcaagcactgcagagagcggccccggtctatggtggtcatc
gaggtgttcacaccagtggttcagaggatccttaaacataatatggactttgggaagtgc
ccaaggctgaggctcttcacccaggagtatattcttgccctgaacgagctcaacgcaggc
atggaggtggtaaagaagttcatacaaagcatgcatggccccacagggcactgcccacat
ccccgggtcctgcccaatctcgtggctgtgtgcctggctgccatatactcctgctatgaa
gagttcatcaacagtcgcgacaactcccccagcctgaaagagatccgaaacggctgccag
cagccatgcgaccgaaagcccaccttacctctgcgtctgctgcaccccagcccggacctg
gtgtctcaggaagccacattgtctgagccacggctgaagtcggtggttgtggcctccagc
gaggtccacgtggaggtggagcgcaccagcactgccaagccggcgctgaccgccagcacg
ggcaacgacagcgagcccaaccttattgactgtctgatggtcagcccagcctgtgggacc
atgagcatcgagctgggcccccaggccggccgcacgctcggttgccacgtggagatcctc
aagctgctgtccgactacgatgactggagaccgtctctggccagcttgcttcaacccatt
ccattccccaaagaagctctcgcccacgagaagttcacaaaggaactgaagtacgtgatt
cagaggtttgcagaagatccaagacaggaagtccactcctgtctgctgagcgtgcgggca
ggcaaggatggctggttccagctctacagccctggaggggtggcctgtgatgatgacggg
gagctgtttgccagcatggtgcacattctcatgggctcctgttacaagaccaaaaagttt
ctgctctcactggcagaaaacaagctgggcccctgtatgctcctggccctgagagggaac
cagaccatggcagagatcctgtgtttgatgctggaatacaacatcatcgacaacaacgac
acccaactgcagatcatctccacgctggagagcacggacgtgggcaagcgcatgtatgaa
cagctgtgcgaccggcagcgggagctgaaggagctgcaaaggaaaggcggacccaccagg
ctaacactgccctccaagtccacggatgcggacctggcccgcctgctgagctctggctcc
tttggaaacctggagaacctcagcttggccttcaccaacgtcaccagtgcctgcgccgag
cacctcatcaaactgccttccctcaagcagctcaatctgtggtccacgcagtttggagac
gccggcctgcggctcctttcggagcacctcactatgctccaagtgctgaacctgtgtgag
accccagtcaccgacgcgggcttgctggccctcagctccatgaagagtctttgcagttta
aatatgaacagcaccaagctctcggctgacacctacgaggatctgaaggccaagcttcct
aacctaaaggaggttgatgttcgctacacggaagcctggtga

DBGET integrated database retrieval system