KEGG   Mus musculus (house mouse): 74446
Entry
74446             CDS       T01002                                 
Symbol
Slc9b1, 1700094G20Rik, 4933424B12Rik, 4933425K02Rik, Nhedc1, mtsNHE
Name
(RefSeq) solute carrier family 9, subfamily B (NHA1, cation proton antiporter 1), member 1
  KO
K23994  solute carrier family 9B (sodium/hydrogen exchanger), member 1/2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    74446 (Slc9b1)
   03037 Cilium and associated proteins [BR:mmu03037]
    74446 (Slc9b1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   74446 (Slc9b1)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Sperm associated proteins
   74446 (Slc9b1)
SSDB
Motif
Pfam: Na_H_Exchanger
Other DBs
NCBI-GeneID: 74446
NCBI-ProteinID: NP_001344986
MGI: 1921696
Ensembl: ENSMUSG00000050150
Position
3:135053754..135103588
AA seq 378 aa
MSEHDVESNKKDDGFQSSVTVEMSKDPDSFHEETVEPKPELKEPEPKEPEPKEPERKEPE
RKEPERKEPERKEPERKVPGRRETQTKETQTTEIERKETKKKRGTNSYCPPQGTINKTIT
DGAALIALWTLLWALIGQEVLPGGNLFGLVVIFYSAFLGGKILEFIRIPVVPPLPPLIGM
LLAGFTIRNVPIIYEFVHIPTTWSSALRNTALTIILVRAGLGLDPQALKHLKGVCLRLSF
GPCFLEACSAALFSHFIMNFPWQWGFLLGFVLGAVSPAVVVPNMLMLQENGYGVEKGIPT
LLVAASSMDDIVAITGFNTFLSIVFSSGSVISNILSSLRDVLIGVLVGIVMGVFVQYFPS
GDQAASTLAYMDLEDWSH
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgagtgagcacgacgtagaatcaaacaagaaggatgatggtttccaatcatctgtaact
gttgagatgtccaaagatcctgatagttttcatgaagaaactgtggaaccaaaaccagaa
ctgaaggaaccggaaccaaaggaaccagaaccgaaggaaccagaaaggaaggaaccagaa
aggaaggaaccagaaaggaaggaaccagaaaggaaggaaccagaaaggaaggtaccagga
agaagggaaacacaaacgaaggaaacacaaacaaccgaaatagaaaggaaggaaacaaaa
aagaagagagggacaaatagttactgtcctccacaaggaacaataaataaaacaattaca
gatggagctgcactcattgcactatggactctactctgggcccttataggtcaagaagtt
ctccctggtggaaatttgtttggacttgtagttattttttacagtgctttccttgggggt
aaaattttagaattcattagaatacctgtagtgcctcccctcccacctctcattgggatg
ttactggctggtttcaccatcaggaatgttccgattatttatgaatttgtccatattcct
accacatggtcttcagctttaagaaacactgcccttactattatcctagtacgagctggg
cttggactggatccacaggccttgaagcatctgaagggagtctgtctgcgcttgtcattt
ggtccatgcttcctagaagcctgctcagccgctctcttctcccacttcattatgaacttt
ccttggcaatgggggttcctactaggttttgtcctaggcgctgtctctcctgctgttgtc
gtccccaacatgctaatgttgcaggagaatgggtatggtgttgagaaaggcatcccgacc
ttgctggtggcagctagcagcatggacgacattgtggccatcactggattcaacacattc
ttgagcatagtcttttcctcgggtagtgtgattagcaacatcctatcgtccttgcgggac
gttcttattggggtgctggtaggaattgttatgggagtttttgttcagtattttccaagt
ggagatcaggctgccagcacattggcttacatggatctggaggactggtcacactag

DBGET integrated database retrieval system