KEGG   Mus musculus (house mouse): 74464
Entry
74464             CDS       T01002                                 
Symbol
Zswim5, 4933426E21Rik, AI503093, mKIAA1511
Name
(RefSeq) zinc finger SWIM-type containing 5
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: SWIM
Other DBs
NCBI-GeneID: 74464
NCBI-ProteinID: NP_001025083
MGI: 1921714
Ensembl: ENSMUSG00000033948
UniProt: Q80TC6
Position
4:116731326..116846461
AA seq 1188 aa
MAEGGEREELLSPPPISPAKRLCSWPSPQAHHPRGTPGAAGGGAGGGGGGCLAPGARPHL
QPESLLDCAAKTVAEKWAYERVEERFERIPEPVQRRIVYWSFPRNEREICMYSSFQYRGG
PGAGAAAGAAGASPVEEGPPPPPGAAAPAGSAPGAAGAGSSPGLGAGTGTASGGCGGGEG
LPFRRGIRLLDSGSVENVLQVGFHLSGTVTEPAMASEPAVTYKVAISFDRCKITSVSCGC
GNKDIFYCAHVVALSLYRIRKPDQVKLRLPISETLFQMNRDQLQKFIQYLITAHHTEVLP
TAQKLADEILSSNSEINQVNGAPDPTAGASIDDENCWHLDEEQVKEQVKLFLSQGGYYGS
GKQLNSMFAKVREMLRMRDSNGARMLTLITEQFMADPRLTLWRQQGTSMTDKCRQLWDEL
GALWVCIILNPHCKLEEKSCWLQQLQKWSDLDICPLEDGNYGHELPNITNALSQSASHSP
DSLSRPRRTVFTRAIEGRELHWQDSHLQRIISSGIYTAPACQRENERLLFNSHGQPLWLE
HVPTACARVDALRSHGYPKEALRLTVAIINTLRLQQQRQLEIYKHQKKELLQRGTTTITN
LEGWVGHPLDPIGCLFLTLTEACRLNDDSYMEMSDMNESRLPVYQHVPVASGCPNSNESY
LSLALEVALMGMGQQRVMPEGLYAQDKVCRNEEQLLSQLQELQLDDELVQTLRKQCILLL
EGGPFSGLGEVIHRESVPMHTFAKYLFSALLPHDPDLSYKLALRAMRLPVLENSSSAGDT
SHPHHMVSVVPSRYPRWFTLGHLESQQCELASTMLTAAKGDTLRLRTLLEAIQKHIHSPS
LIFKLAQDAFKIATPTDSSTDGTLLNVALELGLQVMRMTLSTLNWRRREMVRWLVTCATE
VGVRALVSILQSWYTLFTPTEATSIVAATAVSHTTILRLSLDYPQREELASCARTLALQC
AMKDPQSCALSALTLCEKDHIAFEAAYQIAIDAAAGGMTHSQLFTIARYMELRGYPLRAF
KLASLAMSHLNLAYNQDTHPAINDVLWACALSHSLGKNELAALIPLVVKSVHCATVLSDI
LRRCTVTAPGLAGIPGRRSSGKLMSTDKAPLRQLLDATINAYINTTHSRLTHISPRHYGE
FIEFLSKARETFLLPQDGHLQFAQFIDNLKQIYKGKKKLMLLVRERFG
NT seq 3567 nt   +upstreamnt  +downstreamnt
atggcggaaggaggtgagcgagaggagctgctttcgccgccgccgatctctccggccaag
aggctgtgctcttggcccagcccgcaagctcaccacccccgcgggactcccggggcagcc
ggcggaggggcggggggcggcggcggcggctgcctggcccccggggcccgcccccacctg
cagccggagtccttgctggactgcgccgccaagacggtggcggaaaagtgggcgtacgag
cgggtggaggagcgcttcgagcggatcccggagccggtgcagcgccgcatcgtctactgg
tccttcccgcggaatgagcgggagatctgcatgtactccagcttccagtaccggggcggc
ccgggagccggcgcggctgccggcgcggcgggggcttcgccggtcgaggaggggccgccg
ccaccccccggggccgccgctccggccggctccgcccccggggccgccggggcgggctcg
tcccccgggctgggcgctgggactggaacggcgagcggcggctgcggcggcggcgagggg
ctgccgttccgccggggcatccgtctgctggacagcggctccgtggagaacgtgcttcaa
gtcggcttccatctgagtggcacagtcacggaaccagccatggcttctgagccagcagtg
acttacaaggttgccatcagctttgatcgatgcaaaatcacgtctgtgagctgcggctgt
gggaataaggacatattctactgtgctcacgtggtagcactctctctctaccggatccgg
aaaccagaccaggtcaaacttcgtcttcctatctcagaaacccttttccagatgaacagg
gaccagctacagaagtttattcagtatttaatcacagcacaccacactgaagttcttcct
actgcacaaaagctggcagatgagattctgtcctccaactcagaaatcaaccaagtgaat
ggcgcccctgaccccacagctggggccagcatcgatgatgagaactgttggcacttggat
gaagaacaagtgaaagaacaagtgaagctctttctctcccaggggggttactatggctct
gggaagcagctcaactcaatgtttgccaaggttcgagagatgcttcgaatgagagattct
aatggagccaggatgctgacacttatcactgagcaatttatggctgatccacgcctcaca
ctctggaggcagcaaggaacaagcatgacagacaagtgcaggcagctctgggatgagcta
ggggctttatgggtgtgcataattttaaatccacactgcaaactagaagaaaaatcttgt
tggctccagcaactgcagaagtggagcgacctggatatctgtcccctggaggatggaaac
tatgggcatgagctgcccaacattaccaatgcgctctcccagagtgccagccacagccca
gactctttatccagaccaagacgaacagtcttcactagagccattgaaggtcgtgagttg
cattggcaggacagccacctacaacgaataatcagcagtgggatctatacagctcctgcc
tgccagcgggaaaatgagcgactactctttaattcccatggccagccactgtggcttgag
catgtgcctacagcctgtgctcgggttgatgcactgcgatctcatgggtatccaaaagag
gctctcagactcacggtggccatcattaatactctgaggttgcagcagcagcggcagcta
gagatctacaaacatcagaagaaagagttgttgcagagaggaacgacaacaatcacaaac
ctggagggctgggtgggccatcccctggatcccattggctgcctgtttctcactttgact
gaagcctgccgcctgaatgatgacagctacatggagatgtcagatatgaatgaaagcaga
cttcctgtgtaccagcatgtacctgtggcttcaggctgcccaaacagcaatgagtcgtac
ctgtcactggccctggaggttgctctgatgggcatgggacaacagagagtgatgcctgaa
ggcctctatgcacaggacaaggtgtgccgtaatgaggagcaactcctgagccaactccag
gaactgcagctggatgatgagctagtccagaccctgcgcaaacagtgcatcttactgctg
gagggaggccccttcagcggcctcggagaagtcatccaccgggagagtgttcccatgcac
acctttgcaaagtatctgttctcagctctgctgcctcatgatccagacctgtcttacaag
ttagccttacgcgccatgaggttacctgtgctagaaaactcgtcttccgcaggcgacacg
tcccacccccatcacatggtgtctgtggtacccagccgctatcctcgctggttcacgctc
ggacacttagagtcacagcagtgtgaactggcctccaccatgctgactgctgccaaagga
gacacgctgaggctacgaactcttctggaagcgatacagaagcacatccattctccctcc
ctcatcttcaaactagctcaagatgcattcaagattgctactcccacggacagcagcaca
gacggcactctgctcaacgtggccctggagctggggttacaggtgatgcggatgacctta
tcaacccttaattggaggcgccgagagatggttcgatggctggttacttgtgctacagaa
gtgggtgtgcgggccctggtgagcatcttgcagagctggtacacactcttcaccccgact
gaggctacaagtattgtggctgccacagccgtatcccacaccactatcctgcgcctcagc
cttgactacccacagcgggaggaactggctagctgtgctcgcacactggccctacagtgt
gctatgaaggatccacagagctgtgccttatcagctcttacactttgtgagaaagaccac
attgcctttgaggcagcctaccagattgccattgatgctgctgccggtggcatgactcat
tcacagctgttcaccattgcccgctacatggagctccgtggctacccgctacgtgccttc
aagctggcctcactagccatgagccatcttaacctggcctacaaccaggacacccatcca
gccatcaatgatgtgctctgggcttgtgctctcagccactctctgggcaagaatgaactg
gcagctctcatccccctggtggtgaagagtgtgcactgtgccacagtgctttctgatatc
ctgcgtcggtgcacagtgactgccccaggcctggcaggcatcccaggccgccgcagctcc
ggaaagctcatgtcaacagacaaagccccactgcgccagctactggatgcaaccatcaat
gcctacatcaacaccacacactcccgtctgacacacatcagtccccgccactatggagag
ttcattgagtttctgagcaaagctcgtgagaccttcctactgccccaggatggtcacttg
caatttgcccaattcattgacaacctcaaacagatatacaaaggcaagaagaagctgatg
ctgttggttcgggagcgctttggctga

DBGET integrated database retrieval system