KEGG   Mus musculus (house mouse): 74470
Entry
74470             CDS       T01002                                 
Symbol
Cep72, 2610029E11Rik, 4933440J22Rik
Name
(RefSeq) centrosomal protein 72
  KO
K16532  centrosomal protein CEP72
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    74470 (Cep72)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     74470 (Cep72)
SSDB
Motif
Pfam: LRR_9 LRR_4 LRR_8 Filament GOLGA2L5 DUF6376 Sec34 DUF641 YabA Ntox28 DUF5955 DUF4407 EAD9 DUF1664 DASH_Dam1 TMF_DNA_bd Ax_dynein_light EzrA
Other DBs
NCBI-GeneID: 74470
NCBI-ProteinID: NP_083235
MGI: 1921720
Ensembl: ENSMUSG00000021572
UniProt: Q9D3R3
Position
13:complement(74184351..74210439)
AA seq 646 aa
MAPGQRLVLCEETVRERSGLGPHRDLAELRSLSIPGTYQEKITHLGNSLMHLTALKSLDL
SRNSLVSLEGIQYLVSLESLNLYYNCISSLAEVFRLHTLLELQDVDFRLNPVVKNESDYR
LFVVHMLPKLRQLDDRPVRESERKASQLHFAPEDSLNSKENFSTTLTVGRPHHLRNRCTE
TSAKKCLVMDADDEAVLNLIAECEWDLSNPPGNMSSSQKEHEADLHYAQESRHLLSPLSI
QHQCGDSARRGHEKKKVTSRGCPGHSPQDQLCGELPLQHGLPEACHMHVQHARITSQPDS
VDVEDCASSAQKSSLSSQKTVNPLPVPEKYRKRRMPGGRFQVPSDRECLSFLERADGPSS
LEDSLSRQDGLEGQSQVALSHSEALEAEERTSHGTSDPRVLSPKLCSAAVPERRSTLEVA
LLEALLDLIDRCSSGSGSLHGNEAFLAQAKHVLSSLQEFTATRDSSALEKEGIGYLSLEN
KTLQSRLAEQQQQYTATVTKMTAELNNTKRELDTLRQHLDKSLEENSHLKSLLYNVKKEV
KTADTSTALTLQITGLQASMKQLSGEVVELKQHVEHYDKIQELTQMLQESHSSLVSTNEH
LLQELSRTRAQHRAEVEQMRWSFQEFKKTTALIPHRSSRRGGRQSC
NT seq 1941 nt   +upstreamnt  +downstreamnt
atggcgccaggccagcggttggttttgtgtgaagagactgtacgagagcgcagcggcctg
ggtccccaccgcgacctggctgaacttcgatctttatctattcctggaacataccaagag
aagattactcacctgggaaactctctgatgcacttgacagctctaaaatccttagacctc
tcacgtaactccttggttagccttgagggtatacagtatctggtctccttggagagtctc
aatctctactacaactgtatttcttcattagcagaagtatttaggctccacaccctactg
gagctccaggacgtggacttccggcttaaccccgttgtgaagaatgagtctgactaccgc
ctgtttgtcgtgcacatgctcccgaagctccgacagctagatgaccgtcctgtgagagaa
agtgagcggaaagcttcccagcttcattttgccccagaagattcactgaactcaaaggag
aacttctcaaccactttaaccgttggaagaccacaccacctcagaaacagatgtactgag
acctcggccaaaaaatgcttggtcatggatgctgatgatgaggctgtcctgaaccttatt
gccgagtgtgaatgggacctaagcaatcctcctgggaacatgagctccagccaaaaggaa
catgaagctgacctccattatgcccaagagtccagacatctgttgagtcctttgtccatc
cagcaccagtgtggggattcagcgaggcgaggccatgagaagaagaaagtcacctccaga
gggtgtccaggtcattcaccgcaggaccagctctgtggggaactccccctacagcatggc
ttgccagaggcctgccatatgcacgtacagcatgcccgcatcacttcacagccagactct
gtggatgttgaggactgtgcttcatctgctcagaaatcaagtttgtcatcacaaaaaaca
gtaaatcctttgcctgtccctgaaaagtacaggaagcgaaggatgcctggtgggagattc
caggtgccttcagaccgggagtgtttgagcttcctagagagggctgacgggccctccagc
cttgaggacagtctaagcagacaggatggcttggagggccagagtcaggtggccttgtct
cactctgaggctttggaggctgaagagcggacatctcatggcacaagtgaccccagagtg
ctgtctcctaaactctgctcggcagcggtgcctgagcggaggtccactctggaagtggcc
cttctggaggcgcttctcgacctgatagacaggtgctcaagtggcagtggatccctgcat
ggcaatgaggccttccttgctcaggccaagcatgttttgtcatctcttcaagagttcaca
gcaactcgggacagttcagcacttgaaaaggaaggaattggttacctatctcttgaaaat
aagactctgcaaagccgccttgctgagcaacagcaacagtatactgctacagtgaccaag
atgacagcagagctcaataatacaaagagggagctggacacattgagacaacatttggac
aaatcattggaagagaatagccacttaaagtctcttctgtacaatgtgaaaaaagaagta
aagactgcagacacttcaactgcactcactttgcagatcactggacttcaggcaagtatg
aagcagctctctggggaagttgtggagctgaagcaacacgtggagcactatgacaagatc
caggagctcacacagatgcttcaagagagccacagctccctggtaagcaccaatgagcat
ctcctgcaggagctgagccgcacacgggcacagcatagagctgaggtagagcagatgcgc
tggagcttccaggaatttaagaagactacggccctgatccctcaccgtagctcccgacgt
gggggccggcagtcctgctag

DBGET integrated database retrieval system