KEGG   Mus musculus (house mouse): 74485
Entry
74485             CDS       T01002                                 
Symbol
Lrrc71, 4933430H15Rik
Name
(RefSeq) leucine rich repeat containing 71
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: LRR_6 DUF2857 LRR_8
Other DBs
NCBI-GeneID: 74485
NCBI-ProteinID: NP_083247
MGI: 1921735
Ensembl: ENSMUSG00000023084
UniProt: Q9D3W5
Position
3:complement(87644227..87655930)
AA seq 558 aa
MSSEPSTTGTSPRTPRPGAQKSSGAVTKKGDRAAKDKTASTLPPVGEDEPKNPEEYQCTG
VLETDFAELCTRSGYVDFPKVVTRPRVQQSSVPSASTSEKPVLDDQRPSASCSQSSLESK
YVFFRPTIQVELEQEDSKAVKEIYIRGWKVEDRILGIFSKCLPSLSQLQAINLWKVGLTD
KTLTTFIALLPLCSSTLRKVSLEGNPIPEQSFSKLMGLDSTIVHLSLRNNNINDHGAQLL
GQALSTLQNSNRTLVSLNLAFNHIGDVGAGYIADGLRLNRSLLWLSLAHNHIQDKGALKL
AEVLRPFELTHREVVERRRLLLVKGTQERSRSPSSSRYGDSKAEREKSQTLGISNVTLVD
KQEKMQSLKAPKTISKKKEKTGEVVKKEEKLGSGQSPTQGTPKKEDAAKAGKGKVTIPEQ
KMSKGKATKMGAKEKRSILLESEQLVVEATEMVNPLLEPVEHRDGKVFLPGNKVLLHLNL
LRNQITEVGLEGFLTAVQYQVQVSKPKTSPKAPLGLLWLSLAKNCFDPQCPTHVMIQELM
LPRDPVKAKAREEEAAAT
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgtcaagtgagccaagcactacagggacctcacccaggactccgcgtcctggggcccag
aagtcatccggagcagtaaccaagaagggggatcgggctgctaaagataagacagcaagc
accctgcccccggtgggagaggacgagccaaaaaatccggaggagtaccagtgcacgggg
gtcctggagacagacttcgctgagctctgcacacggtcaggctacgtggactttcccaaa
gttgtcacccggccacgggtccaacagagctctgtcccttccgcctccacgtcagaaaaa
cctgtcctagatgaccagagaccgtcggcatcctgcagccagagcagcctggagagcaag
tatgtgttttttcggcccactattcaagtggagctggagcaggaggacagcaaggccgtg
aaggagatctacattcgaggctggaaagttgaagatcggattctgggtattttctccaaa
tgtctgccctccctcagccagctgcaggccatcaacttgtggaaggtggggctgacggat
aagaccctgaccactttcatcgcccttttgcctctttgttcctccacactcaggaaggta
tctctggaggggaacccaataccagagcagtcctttagtaagctgatgggactggacagc
acgattgttcacttgtctctgaggaacaacaacatcaacgaccacggggcgcagctcctg
ggccaggcgctgtccacactgcagaacagcaaccgaaccctggtttcactgaacctagca
ttcaaccacatcggggatgtgggcgcaggctacattgcggatggcttgaggctgaaccgc
tctctcctctggctgtccctagcgcacaaccacattcaagacaagggagcactgaagctg
gccgaggtcctgcgcccctttgagctgacccacagggaggtggtggagcggcggcgcctg
ctgctggtgaaaggaacgcaggagcggtctcgatcgccttcctcctcccgatacggggac
tccaaagcagaacgtgagaagtctcagacgttggggatcagcaatgtcactttggtggac
aagcaagaaaagatgcagtcactgaaagcccctaagaccataagcaagaaaaaggagaag
acaggggaagttgtcaagaaggaagagaagctgggctctgggcagtcacccacacaagga
acccctaagaaagaagatgccgcaaaggcaggcaaggggaaggtaaccatccctgagcag
aagatgagcaagggaaaagcgacaaagatgggggccaaagagaagcgcagcatcctcctg
gagtcagaacagctggttgttgaagctacagagatggttaaccctctcctggagcccgtg
gaacaccgagatgggaaggtcttcttgcctgggaacaaggtccttttgcacctcaacctc
ctccgaaaccaaatcacagaggtggggctggaaggcttcctcactgctgtgcaataccag
gttcaggtctccaagcccaagacttcacccaaggcccccctgggtctgctgtggctgtcc
ttggcgaaaaactgctttgacccacagtgtccaacacacgtcatgattcaagaactgatg
ttgccaagggaccctgtgaaggccaaggccagggaggaggaggctgcagctacctag

DBGET integrated database retrieval system