KEGG   Mus musculus (mouse): 74499Help
Entry
74499             CDS       T01002                                 

Gene name
Sost, 5430411E23Rik
Definition
(RefSeq) sclerostin
  KO
K16834  sclerostin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    74499 (Sost)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    74499 (Sost)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sclerostin DAN Cys_knot
Motif
Other DBs
NCBI-GeneID: 74499
NCBI-ProteinID: NP_077769
MGI: 1921749
Ensembl: ENSMUSG00000001494
Vega: OTTMUSG00000002135
UniProt: Q99P68 B2RQA5
Structure
PDB: 

Position
11; 11 D
AA seq 211 aa AA seqDB search
MQPSLAPCLICLLVHAAFCAVEGQGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENG
GRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRV
KWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDF
GPETARPQKGRKPRPGARGAKANQAELENAY
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcagccctcactagccccgtgcctcatctgcctacttgtgcacgctgccttctgtgct
gtggagggccaggggtggcaagccttcaggaatgatgccacagaggtcatcccagggctt
ggagagtaccccgagcctcctcctgagaacaaccagaccatgaaccgggcggagaatgga
ggcagacctccccaccatccctatgacgccaaagatgtgtccgagtacagctgccgcgag
ctgcactacacccgcttcctgacagacggcccatgccgcagcgccaagccggtcaccgag
ttggtgtgctccggccagtgcggccccgcgcggctgctgcccaacgccatcgggcgcgtg
aagtggtggcgcccgaacggaccggatttccgctgcatcccggatcgctaccgcgcgcag
cgggtgcagctgctgtgccccgggggcgcggcgccgcgctcgcgcaaggtgcgtctggtg
gcctcgtgcaagtgcaagcgcctcacccgcttccacaaccagtcggagctcaaggacttc
gggccggagaccgcgcggccgcagaagggtcgcaagccgcggcccggcgcccggggagcc
aaagccaaccaggcggagctggagaacgcctactag

DBGET integrated database retrieval system