KEGG   Mus musculus (mouse): 74513Help
Entry
74513             CDS       T01002                                 

Gene name
Neto2, 5530601C23Rik, AI854825, BTCL2
Definition
(RefSeq) neuropilin (NRP) and tolloid (TLL)-like 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: CUB Ldl_recept_a Arm_vescicular
Motif
Other DBs
NCBI-GeneID: 74513
NCBI-ProteinID: NP_001074793
MGI: 1921763
Ensembl: ENSMUSG00000036902
Vega: OTTMUSG00000061423
UniProt: Q8BNJ6
Position
8; 8 C3
AA seq 553 aa AA seqDB search
MGTNAVTHSQTLGRAWGILWKNKDGMSQNDQGHHKKTYRINLPGPIVLLITVLVVEGIAV
AQKTQDGQNIGIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIE
LTFDERYYIEPSFECRFDHLEIRDGPFGFSPLIDRYCGMKSPALIRSTGRFMWIKFSSDE
ELEGLGFRAKYSFIPDPDFTYLGDCQFELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIK
ATPKAKIYLRFLDYQMEHSNECKRNFVAVYDGSSAIENLKAKFCSTVANDVMLKTGVGVI
RMWADEGSRLSRFRMLFTSFVEPPCTSSTFFCHSNMCINNSLVCNGVQNCAYPWDENHCK
EKKKAGLFEQITKTHGTIIGITSGIVLVLLIISILVQVKQPRKKVMACKTAFNKTGFQEV
FDPPHYELFSLREKEISADLADLSEELDNYQKLRRSSTASRCIHDHHCGSQASSVKQSRT
NLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQAHECPEQALEDRVMEEIPCEIYVRG
RDDSAQASISIDF
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgggaacaaatgcagtgacccacagccaaacattaggcagagcttggggaatcctgtgg
aagaataaggatggaatgagccagaatgatcaaggacaccataagaaaacatacagaatt
aacttacctggacccatagtgttgctgataacagtacttgtcgtggaagggattgctgtg
gcccaaaaaacccaagatggacaaaatattggaatcaagcacattcctgcaacccagtgt
ggtatttgggttcgaaccagcaatggaggtcattttgcttcaccaaattatcctgactca
tatccaccaaacaaggagtgtatctatattttggaagctgctcctcgtcaacgaatagag
ctgacctttgatgaacgctattatatagagccatcattcgaatgtcggtttgatcacttg
gaaattcgagacgggccatttggtttttctcctcttatagatcgttactgtggcatgaaa
agccctgcattaattaggtcaacgggaagattcatgtggattaaatttagttctgatgaa
gaacttgaaggactaggatttcgagcaaaatactcattcatcccagatccagactttact
taccttggagattgccagtttgagctctctggagctgatggaatagtacggtctagccaa
gtagagcaagaagagaaaacaaagcctggccaagcagttgattgcatatggacaattaaa
gctactccaaaagctaagatttatttgaggttcctagattaccaaatggaacactcaaat
gaatgcaaaagaaattttgtggcagtctatgatggaagcagtgctatcgaaaatctgaag
gccaagttctgcagcactgtggctaatgatgtcatgttgaaaacaggagtcggagtgatc
cggatgtgggcagacgaaggcagtcggcttagcaggtttaggatgctcttcacttccttt
gtggaacctccctgtacaagcagcactttcttttgccatagcaacatgtgcatcaacaat
tctttagtctgtaatggtgttcaaaactgtgcatacccttgggatgagaatcactgtaaa
gaaaagaaaaaagctggactatttgaacaaatcactaaaactcatgggacaattattggc
attacatcaggaattgtcttggtccttctcattatttctattttagtacaagtgaaacag
ccccggaaaaaggttatggcttgcaaaactgcatttaataaaactgggttccaggaagta
tttgatcctcctcattatgaactattttcactaagagagaaagagatttctgcagatctg
gcagatttgtcagaagaacttgacaactaccagaagttgcggcgctcctccacggcctcc
cggtgcattcacgaccaccactgtggatcacaagcatccagtgtgaaacaaagcaggacc
aacctcagttccatggaacttcccttccgaaatgattttgcacaaccacagccaatgaaa
acatttaatagcaccttcaaaaaaagcagctacactttcaaacaagctcatgagtgccct
gaacaggctctagaggacagagtgatggaggagattccctgtgaaatttatgtcagaggg
cgagacgattctgcacaagcatccatatccatcgacttttaa

DBGET integrated database retrieval system