KEGG   Mus musculus (mouse): 74521
Entry
74521             CDS       T01002                                 

Symbol
Ppp4r4, 8430415E04Rik, mKIAA1622
Name
(RefSeq) protein phosphatase 4, regulatory subunit 4
  KO
K15426  serine/threonine-protein phosphatase 4 regulatory subunit 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    74521 (Ppp4r4)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    74521 (Ppp4r4)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-4
    Regulatory subunits
     74521 (Ppp4r4)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Protein phosphatase 4
     74521 (Ppp4r4)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd PRAS Cnd1
Other DBs
NCBI-GeneID: 74521
NCBI-ProteinID: NP_083256
MGI: 1921771
Ensembl: ENSMUSG00000021209
Vega: OTTMUSG00000049396
UniProt: Q8C0Y0
Position
12; 12 E
AA seq 875 aa
MHPPPPDAGVAMDFGQNSLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIDR
AVYLLSAGQDVQGASVIANLPFLMRQNPTETLRRVLPKVREVLHVASVEMQLTAAVSFLT
ILQEESMSVHTCAHSFLQVILLHLEHRDTGVSNAWLETLLSAVELLPKETLRHEILNPLV
SKAQLSQTVQSRLVSCKILGKITNKFDAHSIKREILPLVKSLCQDVEYEVRSCMCRQLEN
IAQGIGAELTKNVVLPELIELSRDESGSVRLAAFETLVNMLDMFDTDDRSQTILPLVKSF
CEKSFKADESILISLSFHLGKLCHGLYGIFTPDQHLRFLEFYKKLCTLGLQQENGHNESQ
IPSQIVEQEKKYTSVRKNCAYNFPAMIVFVDPKNFHMELYSTFFCLCHDPEVPVRHTIAI
CFYEVSKLLNSGVHLIHKELITLLQDESLEVLDALINHLPEILELMSTGGENSVQENKFS
SVPDLIPALTAAEQRAAASLKWRTHEKLLQKYTCLPHIISSDQIYYRFLQRMFTIMMTNN
VLPVQRAAARTLCIFLRYNRKQEQRHEVIQKLIEQLGQGKSYWNRLRFLDTCEFIIEIFS
RSFFCKYFFLPVIELTHDPVANVRMKLCYLLPKVKSALKIPADMHLLQQLEMCVRKLLCQ
EKDKDVLAIVKKTVLELDRMEMSMDMFQKKNYEKDLLDQEKEREELLFLEMEQLEKEKHQ
SDGRLASDKSFEKKRRDSRTSTQSLSKNLPISVPGPSSSTASTSKEIKKSKLTRSQSFNN
QAFHAKYGTLDKCASKSSTLAHTSSVSGLVRTAMLSLTDDSFRTRNASSVPASFSPNPVM
PSTSRGPGNTADPKSSGSKDAQPRKATLKSRKSNP
NT seq 2628 nt   +upstreamnt  +downstreamnt
atgcatccgccgccgcccgacgccggcgtcgcgatggatttcgggcagaacagcctgttt
ggctacatggaggacctgcaggagctcaccatcatcgagaggccggtccgccggagcctc
aagacaccagaagaaatagaaagactgactgttgatgaagatctcagtgatattgacagg
gctgtttatctgctcagtgctggtcaagatgtccaaggagccagtgtgattgcaaacctt
ccatttttgatgcgacagaatcctactgagacacttcggagagtcttacccaaagtcaga
gaagtcctgcatgtcgcaagcgtggagatgcagctaacggctgcagtgtcctttttgacc
atccttcaggaagaatcaatgtcagtccacacctgtgcacactccttcctgcaagtcatt
ctcctgcacctggagcacagggacacaggtgtcagcaatgcatggctggagacacttctc
tccgcagtagaattattgccaaaagaaaccctgaggcatgagattctcaatccacttgtt
tccaaggcacagctttcccaaaccgtccagtcgcgtttagttagctgtaaaattttagga
aaaataaccaacaaatttgatgcccatagcattaagagagaaatacttcccctggtaaaa
tcactctgtcaagatgtggaatatgaagttcgatcttgtatgtgtcgccagttagaaaac
atagctcagggcattggggcagaactgacaaagaatgtggtgcttcccgaactaatagaa
ctctctagggacgagagtggcagtgtgcggcttgctgcttttgaaaccttggttaacatg
cttgacatgttcgatacagatgacagaagtcaaactatacttcccttagtgaaatcgttc
tgtgaaaagtctttcaaagcagatgaatccattctgatttctttatcatttcatttagga
aagctatgccatggactctatggaattttcactccagatcagcacttgagatttttggag
ttttataagaaactttgtacactgggtttgcaacaagaaaatggccacaatgaaagccag
attccatcccaaatcgtagagcaggagaagaaatatacttcagtacgaaagaactgtgct
tacaactttccggccatgattgtttttgttgatcctaaaaacttccacatggaactctac
tctacattcttctgcctttgtcatgaccctgaagtgccagtcagacacactattgctatt
tgcttttatgaagtatctaaacttctgaattctggagtacatttaattcacaaagagctg
ataacattgttacaagatgagtcactggaggttctagatgctcttataaatcaccttcca
gaaatcttggaacttatgtctactggtggagaaaacagtgttcaagaaaataagttttcc
tcagtgccagacttgattccagcactcacagctgctgagcagcgagctgcagcctccctg
aagtggaggacccacgagaagctgctgcagaagtacacctgtctgcctcatatcatatcg
agtgaccagatttattaccgtttcttacaaagaatgttcaccatcatgatgacaaataat
gtcttacctgtccaaagggcagctgcacgaactctatgcatttttctacgatataatcgt
aaacaagagcagaggcatgaagtcattcaaaaactaattgaacagttgggccaaggaaaa
agttattggaatagacttcgctttttggatacctgtgaatttatcatagagatattttcc
agatcatttttctgcaaatatttctttctacctgttattgaactaacccatgacccagtg
gcaaatgtgagaatgaaactttgctacctgctgcccaaggtgaagtctgcgctgaagatt
cctgcagacatgcatctcctccagcagctagaaatgtgtgtgagaaagctcctgtgtcaa
gaaaaagataaagacgtcctggctattgtgaagaaaacggtattagagttggacagaatg
gagatgtctatggatatgttccagaaaaaaaactatgagaaagatttgttggatcaagag
aaagaaagagaagagctgctgtttttggaaatggaacagctggagaaggagaagcatcag
agtgacgggaggctggccagtgacaaaagctttgagaagaaacgcagagactccaggaca
tcaactcagagcctgtccaagaacttgcccatttctgttcctggaccctcctctagcact
gcatcaacaagcaaagaaatcaagaaatccaaattgactcgaagccaatcttttaataat
caagcttttcatgcaaaatatggcaccttagacaagtgtgctagtaaaagttccacctta
gcacacacgtcttccgtctcagggctggtgaggactgccatgctgtcactaactgatgac
tcattccgaactcgaaatgccagcagtgttccagcttccttttctcctaaccctgtcatg
cccagcacttcccgtgggccaggtaacacagccgatccaaagagtagtggaagtaaagat
gcacagccccggaaggctaccttaaaatccagaaaatccaatccttaa

DBGET integrated database retrieval system