KEGG   Mus musculus (mouse): 74525
Entry
74525             CDS       T01002                                 

Symbol
Fam234b, 8430419L09Rik, mKIAA1467
Name
(RefSeq) family with sequence similarity 234, member B
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: PQQ_2 PQQ FG-GAP
Other DBs
NCBI-GeneID: 74525
NCBI-ProteinID: NP_083258
MGI: 1921775
Ensembl: ENSMUSG00000030207
Vega: OTTMUSG00000024065
UniProt: Q8BYI8
Position
6; 6 G1
AA seq 624 aa
MATVLSRALKLPGKKSPDLGEYDPLTQADSDESEDDLVLNLQQKNGGVKNGKSALGDLPE
PDSDADVAGAAKPHLSEVTPEGFPSEPLGGLEQKATSPLVSYVRTSVFLLTLVISMVLVL
LCAFLIPCPPRDLHSAWSRRLGSQGGGDLSPLELADVNRDGLRDVLLTFVTTRNGTEGGV
GSQPTADLVCLSGMNGSTLWSSPLPEEAQDVTCLDLIPGSVAKTICLVTGTRKMLSAFNA
TSGKVLWTLNPNHLSNGTLAAPVVVLPDLDEDGVRDLVVLAIGELQPDLCFLLVSGRTGS
PVGRPVKYNIVGVGNLIGPQVYITASGAVYILFGFGNIQAVALRDIFVQAQNRDSSPPSL
QIEEPEWEKHRSVNLSELIDVYSDGVELLQLVKAPDSNSSSLLITTRQGLVLLRGQDLTP
HWKLNLQGLRSQPTPGYFTDDQTLDFLLQTQDGDGMKKMTVVDGGSGSIVWSYSIPCHMK
ETPTTSAITSDQKSVFLFWAEALTAASLSSDDSSGAEPPGLYHLYLLHPAFPSILLDLSN
TTGIVTASEVGINDIWKDAFYVTRTTGMSPEGHPTSLVVSKLSLRWALMEGQMVQLKETT
PKIGRGELRRFLSRIKFVDSPYQI
NT seq 1875 nt   +upstreamnt  +downstreamnt
atggcgacagtgctgtccagggctctcaagctcccggggaagaagagcccagacctcggt
gagtacgaccccctcacgcaggccgacagtgatgagagcgaagatgatctcgtgcttaac
ttgcagcagaagaatggaggggtcaaaaacgggaagagtgccctgggagacctgccagag
cccgactcagatgccgatgtggctggggcggcaaagccacatctttcagaagtcacccca
gagggtttcccctcggaaccccttgggggcctggagcagaaggccacctctcccctggtg
tcctatgtgcgcacgtctgtcttcctgctgacactggtgatctccatggttctggtattg
ctctgcgccttcctcatcccctgccctcccagagacctgcatagcgcttggagccggcgc
ctgggctcccaaggaggcggggacctgtctcccctggagttggctgacgtgaatagagat
ggtctgcgggacgtgctgctcacctttgtgacaaccaggaatgggactgaaggaggtgtt
ggctcacaaccaactgcagatctggtgtgcctttcggggatgaacggcagcacactgtgg
tccagtcccctcccagaggaggctcaagatgtcacatgcttagatctgataccaggaagt
gtggccaaaaccatctgccttgtgacggggactcgcaagatgctcagcgcattcaatgcg
acgtcagggaaagtcctctggactctgaacccaaaccatctgtccaacggtaccttggca
gccccggttgtggtgctgccagaccttgatgaagatggtgtcagagatctggtggtgctg
gccattggagaactgcagccagatctgtgttttctgctggtatctggccggacagggagt
cctgtgggccgacctgtgaagtataacatcgtgggagtagggaatctgattggtccccag
gtttacatcaccgccagtggagctgtctacatcctgtttggctttggaaacatacaagct
gtcgccctgcgggacatttttgttcaggcccaaaatcgggacagctcgccaccctctctg
cagatagaggagccggagtgggagaagcacagatctgtcaacctttcagagctcatcgat
gtttacagtgatggagttgagcttctccagttggtgaaggcgccagattccaacagcagc
agcctcctgattacaacccgacaaggcctggtcctgcttagaggacaagatcttacgcct
cattggaaactgaaccttcagggcctgcgcagccagcccactcctgggtatttcactgat
gaccagacattggacttccttctgcagacacaagatggagatgggatgaaaaagatgaca
gtggtagatggaggttctggctccatcgtctggagttacagtattccatgtcacatgaag
gaaacgccaaccacttctgcaattacttcagaccagaagtctgtcttcctcttctgggca
gaggcactgactgctgcatctctcagttctgacgacagctcaggagcggagcctcctggc
ctttaccacctttacctcctgcacccagccttcccctccatcctcctggacctgagcaac
accactggcatagtgacagcttcggaggttggaatcaacgacatctggaaagatgccttt
tatgtcaccaggacaacagggatgagccctgaaggacaccctacctctctggtggtcagc
aagcttagcctgcgctgggcactcatggaaggccagatggtccagctgaaggagaccacc
cctaaaattggccgtggggaactgcgaagattcctgtctaggataaagtttgttgattct
ccctaccagatctag

DBGET integrated database retrieval system