KEGG   Mus musculus (mouse): 74528
Entry
74528             CDS       T01002                                 

Symbol
Mgme1, 8430406I07Rik, AI426476
Name
(RefSeq) mitochondrial genome maintenance exonuclease 1
  KO
K19465  mitochondrial genome maintenance exonuclease 1 [EC:3.1.-.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    74528 (Mgme1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     74528 (Mgme1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    74528 (Mgme1)
SSDB
Motif
Pfam: PDDEXK_1
Other DBs
NCBI-GeneID: 74528
NCBI-ProteinID: NP_001276559
MGI: 1921778
Ensembl: ENSMUSG00000027424
Vega: OTTMUSG00000003459
UniProt: Q9CXC3
Position
2; 2 G1
AA seq 338 aa
MKLPLTFCRLLSRLNRFSVKASPPVSFSTFSYLCSQKKKNSYEAVDQAKYSRLVRSVLSR
GPAQTPESLFKEDDVLYGPVSKHKAAEPEPQARVPQHCFPIFNEERTGKPHTDASSSPLK
IPLQRNSIPSVTRILQQTMPPEQSFFLERWKERMVLELGEDGFAEYTSNVFLQGKQFHKA
LESILSPQENLTGGEEHPQCGYIESIQHILTEISGVQALESAVQHEALKYVGLLDCVAEY
RGKLCVIDWKTSEKPKPLIRNTYDNPLQVVAYMGAVNHDAHYSFQVQCGLIVVAYKDGSP
AHPHFMDEELCSKYWAKWLLRLEEYTEKQKNLSAPEPA
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaaactgcctctgaccttctgcaggctgcttagcaggttaaacagattttctgtaaaa
gcaagccctcctgtgagtttctccactttctcttatttgtgtagccagaagaagaaaaac
tcttacgaagcagtagaccaagcgaagtactctcgtttagtacgctctgtcttgtccaga
ggcccggcccagactccagagtcgttgttcaaggaagatgatgtactgtatggaccagtg
agtaagcataaggctgcagagccggagccacaggccagagtcccacaacactgctttcct
atcttcaatgaagagagaaccgggaaaccacacacagatgcttcttcaagccctttgaag
atccctttgcaaaggaactcgatacccagtgtgacccgcatccttcagcagaccatgcca
cctgaacagagcttctttttggagaggtggaaagagcggatggttctggagctgggagaa
gacgggtttgcagaatatacttcaaatgtgtttttacaaggcaaacagttccataaagcc
ttggaaagcatactgtcaccccaggagaacctaacagggggagaagagcacccccagtgt
ggctacatcgaaagcatccagcatattctgacagaaatcagtggtgtgcaagctctggag
agtgccgtccagcatgaggccttgaagtatgtagggctgctggactgtgtggctgagtac
cggggcaagctgtgtgtgattgattggaagacatcagaaaaaccaaaacctttaattcga
aatacatatgacaacccgctgcaagttgtggcgtacatgggtgccgtaaaccatgatgcc
cactacagttttcaggttcagtgtggattaattgtggtggcctataaggatgggtcccct
gcgcaccctcacttcatggatgaagagctctgttccaagtattgggccaagtggcttctc
cgactagaagaatatacagaaaagcaaaagaacctgagcgctccagagccagcgtag

DBGET integrated database retrieval system