KEGG   Mus musculus (mouse): 74533
Entry
74533             CDS       T01002                                 

Symbol
Gzf1, 8430437G08Rik, Zfp33, Zfp336, mGZF1
Name
(RefSeq) GDNF-inducible zinc finger protein 1
  KO
K22402  GDNF-inducible zinc finger protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    74533 (Gzf1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    74533 (Gzf1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-met zf-C2H2_6 BolA zf-C2H2_8 zf-C2H2_11 DUF3268 zf-C2H2_3rep AC_N zf-C2HC_2
Other DBs
NCBI-GeneID: 74533
NCBI-ProteinID: NP_083262
MGI: 1921783
Ensembl: ENSMUSG00000027439
Vega: OTTMUSG00000015714
UniProt: Q4VBD9
Position
2; 2 G3
AA seq 706 aa
MESGTVLLESKSSPLNLLHEMHELRLLGHLCDVTVSIENQGVHEDFMAHKAVLAATSKFF
KEVFLNEKSADGTRTNVYLNEVQAVDFASFLEFVYTAKVRVEEDRVQQMLEVAEKLKCLD
LSETCLQLKKQMLESVLLELQNFSESQEVEASSGPQVSVTPSSKASVPGEDAHSNGLVDS
SDYPIERLGNGLSPETPSKKCKEKLDKKKDVAKPPFPKIRRASGRLAGKKVFVEIPKKKY
TRRLREQQKSAEEAAENDKCPQDQSPDNERMETEPAAKSEACPASVELEESLQKVEGEKE
EEEGKDGEEKKKSNFQCTVCDKAFLYEKSFLKHIKYHHGVATEVVYRCDTCGQTFANRCN
LKSHQRHVHSSERHFPCEMCAKKFKRKKDVKRHVLQVHEGGGERHRCGQCGKGLSSKTAL
RLHERTHTGDKPYGCTKCDAKFSQPSALKTHLRVHTGERPFVCDECGARFTQNHMLIYHK
RCHTGERPFMCETCGKSFASKEYLKHHNRIHTGSKPFKCEVCLRTFAQRNSLYQHIKVHT
GERPYCCDQCGKQFTQVNALQRHHRIHTGEKPYMCNACGRTFTDKSTLRRHTSIHDKNTP
WKSFLVIVDGSPKNDEGHKTEQPDDEYASPKLSDRLLSFGENSHFNNLLEVQGNVPAVQE
NSSTGAACKAVVSQDALLTTSISALGELTPQAVSMPAHLPSLTNME
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggaaagtggcacagttttgctggaatccaaatcttcaccactcaaccttctgcatgag
atgcatgagctccgccttctgggccacttgtgtgatgtcactgttagcatagagaaccag
ggtgtccatgaagacttcatggcccataaagcagtgctggcggccaccagcaagtttttt
aaggaggtgttcctaaacgagaagagtgcagatggaaccaggactaatgtttacttgaat
gaagttcaggctgttgactttgcttcgtttctggagtttgtctatactgccaaagtgcgg
gtagaagaagaccgtgtgcagcagatgctcgaagtggctgagaagctaaagtgtttggac
ctgtctgaaacatgcttgcagctaaagaagcagatgctggagtctgtccttttggaattg
cagaatttctctgagtctcaggaggtggaggccagcagtggcccccaggtgagtgtgacc
cccagctccaaagcaagtgtaccaggggaggatgctcactccaatggccttgtagattcc
tccgactacccaatagagagactgggcaatgggctctcaccagaaacaccatccaagaag
tgtaaggagaaactggacaagaagaaagatgtggctaagcctcccttccctaaaatcaga
agagcaagtgggaggctggctggaaaaaaggtgtttgtggaaatccccaaaaagaaatat
acaagaaggctccgagaacagcagaaaagtgctgaggaagccgcagagaatgacaagtgt
cctcaggaccaaagcccagacaatgagaggatggagactgagccagctgccaaaagtgag
gcttgccctgctagtgtagaactggaggaaagcctgcagaaagtggagggggagaaggaa
gaggaagaaggaaaggacggggaggagaagaagaagagtaacttccagtgcacagtctgt
gacaaggccttcctgtacgagaagagtttcctgaaacatatcaagtaccaccatggtgtg
gccaccgaagtggtgtaccgatgtgacacttgtggccagacctttgccaaccgctgcaac
ctgaagagccaccagcgccacgtgcacagcagcgagcgccacttcccgtgtgaaatgtgt
gccaagaagttcaaacgcaagaaagatgtgaaacggcatgtgctgcaggtgcatgagggt
ggtggcgagcggcaccgctgtggccagtgtggcaaaggcctgagctccaagactgctctg
cggctgcacgagcgcacacacacaggcgacaagccctatggctgtaccaagtgtgatgcc
aagttctcacagccatcagctcttaaaacccacctgagagttcatacaggggaaagacct
tttgtctgtgatgaatgtggtgcaagattcactcagaaccacatgctgatttatcataaa
aggtgccacacaggtgaaaggcctttcatgtgtgagacatgtggcaagagttttgcttct
aaggagtacttaaagcatcataacagaatccacactggatcgaagccctttaaatgtgaa
gtgtgcttgcggacctttgctcagcgcaattccctgtaccagcatattaaagtccacacg
ggagagcggccttattgttgtgaccagtgtgggaagcagttcacccaggtaaatgccctc
cagcgccaccatcgcatccacactggggagaagccatacatgtgcaatgcatgtggacgg
acttttactgacaagtctactctccggaggcatacctcaatacatgataagaatacgccg
tggaagtctttccttgtcattgtagatggctcacccaagaatgatgaagggcataagaca
gaacaacccgatgatgaatatgcatcacccaaactttcagatcgattactatcttttggt
gaaaatagccatttcaacaacttactggaagtccaaggcaatgtgcctgccgtgcaggag
aacagctctacaggcgctgcttgcaaagcagtggtgtctcaggacgctctgcttaccact
tccatcagtgcccttggtgagctcaccccacaggcagtttccatgcctgcacaccttccc
tccttgaccaatatggagtga

DBGET integrated database retrieval system