KEGG   Mus musculus (mouse): 74549
Entry
74549             CDS       T01002                                 

Gene name
Mau2, 9130404D08Rik, A930019L04Rik, C77863, C79014, Mau-2, mKIAA0892
Definition
(RefSeq) MAU2 sister chromatid cohesion factor
  KO
K11266  MAternally affected uncoordination
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    74549 (Mau2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    74549 (Mau2)
SSDB
Motif
Pfam: Cohesin_load TPR_2 TPR_12 TPR_MalT TPR_19 HemY_N
Other DBs
NCBI-GeneID: 74549
NCBI-ProteinID: NP_083269
MGI: 1921799
Ensembl: ENSMUSG00000031858
Vega: OTTMUSG00000062224
UniProt: Q9D2X5
Position
8; 8 B3.3
AA seq 618 aa
MAAQAAAAAQAAAAAQAAAAQAAQAEAAESWYLALLGFAEHFRTSSPPKIRLCVHCLQAV
FPFKPPQRIEARTHLQLGSVLYHHTKNSEQARSHLEKAWLISQQIPQFEDVKFEAASLLS
ELYCQENSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEY
ARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLV
LQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYL
VTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKA
TALQEISQVCQLCQQSPRLFSNHAAQLHTLLGLYCVSVNCMDNAEAQFTTALRLTNHQEL
WAFIVTNLASVYIREGNRHQELYSLLERINPDHSFPVSSHCLRAAAFYVRGLFSFFQGRY
NEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNHRESNNMVVPAMQLASKIPDM
SVQLWSSALLRDLNKACGNAMDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWTDGPP
PVQFQAQNGPNTSLASLL
NT seq 1857 nt   +upstreamnt  +downstreamnt
atggcggcacaggcggcggctgcggcgcaggcggcggctgcagctcaggctgccgccgca
caggccgcacaggccgaggcagccgagtcgtggtatctggctctcctgggtttcgccgag
cacttccgaacatctagcccgcccaagatccgcttgtgcgttcattgcctgcaggccgtg
ttccccttcaagccgcctcagcggatcgaggcccggacgcacctgcagctcggctcggtg
ctttaccaccacacgaagaacagcgagcaggcgcgcagccacctggagaaggcgtggttg
atatcacagcaaatcccacagtttgaagatgttaaatttgaggcagcaagcctgttgtca
gagctgtattgtcaagagaactccgtggatgcagcaaaaccactgctgcggaaagccatc
cagatctcacaacagacgccatactggcactgtcgcctgctcttccagctcgctcaactg
cacacactggagaaggacctggtatccgcctgtgacctcctaggcgtgggggctgagtat
gcccgagtggtgggatctgaatatacaagggcattattcctgctcagcaaggggatgctg
ctgttgatggagcgcaaactgcaagaggtgcacccactgctcacactgtgtgggcagatt
gtagagaactggcagggcaaccccatccagaaggagtcactacgtgtcttcttcctggtg
ctgcaggtgacccactacctggatgctgggcaggtgaagagcgtcaagccgtgcctgaag
cagctgcagcagtgcattcagaccatctccacactacatgatgatgaaatcctgcccagc
aaccctgctgacctcttccactggctgcccaaggagcacatgtgtgtgctcgtctacctg
gtcacagtgatgcattcgatgcaggctggttacctggagaaggcacagaagtacacagac
aaggcgctcatgcagttggagaagcttaagatgctggactgcagccctatcctgtcgtct
ttccaagtgatcctgctggagcatatcatcatgtgccggcttgtcacaggccacaaggcc
actgcactacaggagatctcccaggtctgccagctatgccagcagtcccctaggctcttc
tccaaccatgctgcccagttgcacacactgttgggcctgtattgtgtctccgtgaactgc
atggataatgctgaagcccaatttaccacagcccttcggctcaccaaccaccaggagttg
tgggccttcatcgtgaccaaccttgcgagtgtgtatatacgagaaggaaatagacaccaa
gagctgtacagtttgcttgagaggataaacccggaccacagcttcccggtcagctcacac
tgcctccgagcagcagccttctacgtgcgagggctcttctccttcttccagggccgctac
aacgaagccaagcggtttcttcgagaaactctgaagatgtcaaatgcagaggacctgaac
cgcctcacagcctgctcccttgtgctgctgggtcacatcttctatgtgttgggaaatcac
agggagagtaacaacatggtggtacctgccatgcagctggccagcaagatcccagacatg
tctgtgcagctgtggtcatctgccctcctgagagacctaaacaaggcatgtgggaacgcc
atggatgcccatgaagccgcacagatgcaccagaacttctcacagcagctgctgcaggac
cacatcgaggcctgtagcctcccagagcacaacctcattacgtggacagatggcccaccc
cctgtgcagttccaagctcagaatggacccaacaccagcctggccagccttctgtga

DBGET integrated database retrieval system